Result : V9HVX0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YpaA |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 2357816 |
| Right | 2358001 |
| Strand | + |
| Nucleotide Sequence | ATGACTATTGCTGAACGGCTGCGGCAGGAAGGACATCAAATTGGCTGGCAGGAAGGTAAATTAGAAGGTTTGCATGAACAAGCCATTAAAATTGCTTTGCGCATGCTGGAACAGGGCTTTGATCGTGACCAGGTGCTCGCGGCCACCCAGCTAAGCGAAGCCGATCTGGCAGCGAATAACCACTAA |
| Sequence | MTIAERLRQEGHQIGWQEGKLEGLHEQAIKIALRMLEQGFDRDQVLAATQLSEADLAANNH |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | V9HVX0 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2357816 | 2358001 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2357633 | 2357803 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 3087140 | 3087337 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1361532 | 1361729 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 2374386 | 2374607 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 4438150 | 4438347 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 4375920 | 4376093 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 2358178 | 2358387 | + | NZ_AP014857.1 | Escherichia albertii |
| 9 | 2424058 | 2424231 | - | NZ_AP014857.1 | Escherichia albertii |
| 10 | 2899810 | 2900007 | + | NZ_LR134340.1 | Escherichia marmotae |
| 11 | 3667678 | 3667863 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 12 | 1516899 | 1517096 | + | NZ_CP053416.1 | Salmonella bongori |
| 13 | 4587743 | 4587940 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 14 | 2256991 | 2257200 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 15 | 856796 | 856981 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 16 | 2609365 | 2609550 | - | NZ_CP033744.1 | Citrobacter freundii |
| 17 | 4253115 | 4253312 | + | NZ_CP033744.1 | Citrobacter freundii |
| 18 | 780282 | 780494 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07690.18 | 0.85 | 11 | 3178.5 | opposite-strand | Major Facilitator Superfamily |
| 2 | PF01266.26 | 0.62 | 8 | 3358.0 | same-strand | FAD dependent oxidoreductase |
| 3 | PF04324.17 | 0.62 | 8 | 3358.0 | same-strand | BFD-like [2Fe-2S] binding domain |
| 4 | PF16901.7 | 0.62 | 8 | 3358.0 | same-strand | C-terminal domain of alpha-glycerophosphate oxidase |
| 5 | PF00890.26 | 0.62 | 8 | 2109.0 | same-strand | FAD binding domain |
| 6 | PF02754.18 | 0.62 | 8 | 922.0 | same-strand | Cysteine-rich domain |
| 7 | PF13183.8 | 0.62 | 8 | 922.0 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF13534.8 | 0.62 | 8 | 922.0 | same-strand | 4Fe-4S dicluster domain |
| 9 | PF12838.9 | 0.62 | 8 | 922.0 | same-strand | 4Fe-4S dicluster domain |
++ More..