Result : V6F244
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Magnetosome protein Mms5 |
| NCBI Accession ID | |
| Organism | Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MLSAKGVSLGLGLGLGAWGPVLLGVVGVAGALALYGYYKNRNAEPAAAEAV |
| Source of smORF | Swiss-Prot |
| Function | Might be involved in magnetite crystal growth. {ECO:0000250|UniProtKB:Q2W8J4}. |
| Pubmed ID | 24625872 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | V6F244 |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2444614 | 2444769 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 2 | 2514418 | 2514576 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 3 | 2513003 | 2513182 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 4 | 1086996 | 1087151 | - | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 5 | 1015748 | 1015906 | - | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_023065.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09851.11 | 1.0 | 2 | 1731.0 | opposite-strand | Short C-terminal domain |
| 2 | PF02421.20 | 1.0 | 2 | 831.0 | opposite-strand | Ferrous iron transport protein B |
| 3 | PF07670.16 | 1.0 | 2 | 831.0 | opposite-strand | Nucleoside recognition |
| 4 | PF07664.14 | 1.0 | 2 | 831.0 | opposite-strand | Ferrous iron transport protein B C terminus |
| 5 | PF17910.3 | 1.0 | 2 | 831.0 | opposite-strand | FeoB cytosolic helical domain |
| 6 | PF01926.25 | 1.0 | 2 | 831.0 | opposite-strand | 50S ribosome-binding GTPase |
| 7 | PF04023.16 | 1.0 | 2 | 2981.5 | opposite-strand | FeoA domain |
| 8 | PF07219.15 | 1.0 | 2 | 2855 | opposite-strand | HemY protein N-terminus |
++ More..