Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem I reaction center subunit IX |
NCBI Accession ID | CP000828.1 |
Organism | Acaryochloris marina (strain MBIC 11017) |
Left | 1430824 |
Right | 1430979 |
Strand | - |
Nucleotide Sequence | ATGGGCGATGTCCCACTCAAAATTGATTCGGAGAAAGATTTTATGAAGTTTTTTAGTACGGCTCCTGTGATTGCTTTGGTCTTTTTTACCCTTACAGCAGGTTTTCTGGTTGAGCTAAATCGCTTTTTCCCAGATATCTTGTTCTTCCCTTACTAA |
Sequence | MGDVPLKIDSEKDFMKFFSTAPVIALVFFTLTAGFLVELNRFFPDILFFPY |
Source of smORF | Swiss-Prot |
Function | May help in the organization of the PsaE and PsaF subunits. {ECO:0000255|HAMAP-Rule:MF_00522}. |
Pubmed ID | 18252824 |
Domain | CDD:420030 |
Functional Category | Others |
Uniprot ID | B0C7S6 |
ORF Length (Amino Acid) | 51 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1430824 | 1430979 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
2 | 3411957 | 3412106 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
3 | 2975515 | 2975664 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
4 | 4875708 | 4875857 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
5 | 5099507 | 5099656 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
6 | 679685 | 679834 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
7 | 3106894 | 3107043 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
8 | 3171891 | 3172034 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
9 | 2220418 | 2220546 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
10 | 5549867 | 5550016 | - | NZ_CP031941.1 | Nostoc sphaeroides |
11 | 4211954 | 4212103 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02605.17 | 0.82 | 9 | 274 | same-strand | Photosystem I reaction centre subunit XI |
2 | PF00814.27 | 1.0 | 11 | 801 | opposite-strand | tRNA N6-adenosine threonylcarbamoyltransferase |
3 | PF04025.14 | 0.73 | 8 | 1668.0 | opposite-strand | Domain of unknown function (DUF370) |
4 | PF00625.23 | 0.73 | 8 | 863.0 | opposite-strand | Guanylate kinase |
5 | PF12697.9 | 0.73 | 8 | 1936.0 | same-strand | Alpha/beta hydrolase family |
6 | PF12146.10 | 0.73 | 8 | 1936.0 | same-strand | Serine aminopeptidase, S33 |
7 | PF00561.22 | 0.64 | 7 | 1928 | same-strand | alpha/beta hydrolase fold |