Protein Information |
Information Type | Description |
---|---|
Protein name | COP-associated protein (Copper ion-binding protein) |
NCBI Accession ID | AE001439.1 |
Organism | Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99) |
Left | 383426 |
Right | 383626 |
Strand | - |
Nucleotide Sequence | ATGAAAGTAACTTTTCAAGTGCCAAGCATTACTTGTAACCATTGCGTGGATAAAATTGAAAAATTTGTGGGCGAAATTGAAGGCGTGAGCTTTATTGATGCGAGCGTGGAAAAAAAGAGCGTGGTTGTAGAATTTGACACCCCAGCGACACAGGATTTGATTAAGGAAGCCTTATTGGATGCGGGGCAAGAAGTGGTGTGA |
Sequence | MKVTFQVPSITCNHCVDKIEKFVGEIEGVSFIDASVEKKSVVVEFDTPATQDLIKEALLDAGQEVV |
Source of smORF | Swiss-Prot |
Function | Part of a cation-transporting system which is associated with copper export out of the H.pylori cells. |
Pubmed ID | 9923682 |
Domain | CDD:412222 |
Functional Category | Metal-binding |
Uniprot ID | Q9ZM70 |
ORF Length (Amino Acid) | 66 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1027513 | 1027713 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
2 | 1351251 | 1351433 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
3 | 379020 | 379220 | - | NC_017379.1 | Helicobacter pylori Puno135 |
4 | 663198 | 663410 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
5 | 1885958 | 1886158 | + | NZ_AP018676.1 | Helicobacter cinaedi |
6 | 1893706 | 1893906 | + | NZ_AP018676.1 | Helicobacter cinaedi |
7 | 1238700 | 1238900 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
8 | 1723835 | 1724047 | - | NZ_LN907858.1 | Helicobacter typhlonius |
9 | 272965 | 273168 | + | NZ_LS483446.1 | Helicobacter mustelae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01434.20 | 0.62 | 5 | 3184 | same-strand | Peptidase family M41 |
2 | PF00004.31 | 0.62 | 5 | 3184 | same-strand | ATPase family associated with various cellular activities (AAA) |
3 | PF17862.3 | 0.62 | 5 | 3184 | same-strand | AAA+ lid domain |
4 | PF07728.16 | 0.62 | 5 | 3184 | same-strand | AAA domain (dynein-related subfamily) |
5 | PF01066.23 | 0.62 | 5 | 2223 | same-strand | CDP-alcohol phosphatidyltransferase |
6 | PF00122.22 | 1.0 | 8 | 10.0 | same-strand | E1-E2 ATPase |
7 | PF00702.28 | 1.0 | 8 | 10.0 | same-strand | haloacid dehalogenase-like hydrolase |
8 | PF00403.28 | 1.0 | 8 | 10 | same-strand | Heavy-metal-associated domain |
9 | PF00664.25 | 0.62 | 5 | -3 | same-strand | ABC transporter transmembrane region |
10 | PF00005.29 | 0.62 | 5 | -3 | same-strand | ABC transporter |