Result : Q9ZM67
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein jhp_0355 |
| NCBI Accession ID | AE001439.1 |
| Organism | Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99) |
| Left | 386564 |
| Right | 386824 |
| Strand | - |
| Nucleotide Sequence | GTGCGATCTTGCAAACAGATTTTTGATAAGGGTTTAAAGCCCTATTATAAACATTCTGTTTGCTTAAAGCCTTTTTTTAGGTTTTGTTTTCTCAAAATTCATGCTTATCAACAGCGTTATAGAGCGTTTGCTCTAACGCTCTTTTCTTGTAAGTTTTTTAACGCTTGTAAGATTTTTATTCCCATAATTGATTTTAAAATCGTTTTTATCCCTATTCTAAAACACCAAGCCAAGCTAAAAAGAGTCTCTAATGCCTATTAA |
| Sequence | MRSCKQIFDKGLKPYYKHSVCLKPFFRFCFLKIHAYQQRYRAFALTLFSCKFFNACKIFIPIIDFKIVFIPILKHQAKLKRVSNAY |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9923682 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9ZM67 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 382146 | 382400 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 1024332 | 1024577 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00403.28 | 1.0 | 2 | 1818.0 | same-strand | Heavy-metal-associated domain |
| 2 | PF00122.22 | 1.0 | 2 | 705.0 | same-strand | E1-E2 ATPase |
| 3 | PF00702.28 | 1.0 | 2 | 705.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 4 | PF01066.23 | 1.0 | 2 | -5.0 | same-strand | CDP-alcohol phosphatidyltransferase |
| 5 | PF01434.20 | 1.0 | 2 | 3.0 | same-strand | Peptidase family M41 |
| 6 | PF00004.31 | 1.0 | 2 | 3.0 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 7 | PF17862.3 | 1.0 | 2 | 3.0 | same-strand | AAA+ lid domain |
| 8 | PF07728.16 | 1.0 | 2 | 3.0 | same-strand | AAA domain (dynein-related subfamily) |
| 9 | PF13649.8 | 1.0 | 2 | 1914.5 | same-strand | Methyltransferase domain |
| 10 | PF08242.14 | 1.0 | 2 | 1914.5 | same-strand | Methyltransferase domain |
| 11 | PF00072.26 | 1.0 | 2 | 2904.5 | same-strand | Response regulator receiver domain |
| 12 | PF01856.19 | 1.0 | 2 | 3557.0 | opposite-strand | Helicobacter outer membrane protein |
++ More..