Result : Q9ZLP5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative Fe(2+) transport protein A |
| NCBI Accession ID | AE001439.1 |
| Organism | Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99) |
| Left | 579669 |
| Right | 579905 |
| Strand | - |
| Nucleotide Sequence | ATGACGCTCAATGAAGCCATTAAAGACAAAACTTATGAAATTGTAGAAATCGCTAACTGCGATGAAGCCCTTAAAAAACGCTTCCTCTCTTTTGGTATTCATGAAGGGGTTCAATGCACCCTTTTGCATTCTTCCATGAAAAAGGCCACGCTTTCAATTAAAATCAACCGCATTCAAGTGGCTTTAAGATCCCATGAAGCGCAATACCTTATCATCAAAGAAAGCGCGCAAGAATGA |
| Sequence | MTLNEAIKDKTYEIVEIANCDEALKKRFLSFGIHEGVQCTLLHSSMKKATLSIKINRIQVALRSHEAQYLIIKESAQE |
| Source of smORF | Swiss-Prot |
| Function | Might be involved in Fe(2+) ion uptake (By similarity). {ECO:0000250|UniProtKB:P0AEL3}. |
| Pubmed ID | 9923682 |
| Domain | CDD:412598 |
| Functional Category | Others |
| Uniprot ID | Q9ZLP5 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1238218 | 1238448 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 2 | 572834 | 573064 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 3 | 273131 | 273367 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 4 | 78542 | 78769 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02775.23 | 0.75 | 3 | 5496 | opposite-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 2 | PF01855.21 | 0.75 | 3 | 4367 | opposite-strand | Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg |
| 3 | PF17147.6 | 0.75 | 3 | 4367 | opposite-strand | Pyruvate:ferredoxin oxidoreductase core domain II |
| 4 | PF00037.29 | 0.75 | 3 | 4026 | opposite-strand | 4Fe-4S binding domain |
| 5 | PF12838.9 | 0.75 | 3 | 4026 | opposite-strand | 4Fe-4S dicluster domain |
| 6 | PF13237.8 | 0.75 | 3 | 4026 | opposite-strand | 4Fe-4S dicluster domain |
| 7 | PF12837.9 | 0.75 | 3 | 4026 | opposite-strand | 4Fe-4S binding domain |
| 8 | PF12797.9 | 0.75 | 3 | 4026 | opposite-strand | 4Fe-4S binding domain |
| 9 | PF13187.8 | 0.75 | 3 | 4026 | opposite-strand | 4Fe-4S dicluster domain |
| 10 | PF02618.18 | 1.0 | 4 | 2850.5 | opposite-strand | YceG-like family |
| 11 | PF13109.8 | 1.0 | 4 | -3.0 | same-strand | AsmA-like C-terminal region |
| 12 | PF00730.27 | 1.0 | 4 | 2.5 | same-strand | HhH-GPD superfamily base excision DNA repair protein |
| 13 | PF00633.25 | 1.0 | 4 | 2.5 | same-strand | Helix-hairpin-helix motif |
| 14 | PF10576.11 | 1.0 | 4 | 2.5 | same-strand | Iron-sulfur binding domain of endonuclease III |
| 15 | PF01052.22 | 1.0 | 4 | 726.5 | same-strand | Type III flagellar switch regulator (C-ring) FliN C-term |
| 16 | PF03544.16 | 1.0 | 4 | 1961.0 | same-strand | Gram-negative bacterial TonB protein C-terminal |
| 17 | PF13116.8 | 0.75 | 3 | -3 | same-strand | Protein of unknown function |
++ More..