Result : Q9ZKH6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0150 protein jhp_0960 |
| NCBI Accession ID | AE001439.1 |
| Organism | Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99) |
| Left | 1065063 |
| Right | 1065281 |
| Strand | + |
| Nucleotide Sequence | ATGCTTATAAACGCTGTCATAGAAAAAGATGAGAATGGGTATTTTGCTTTTGTCCCCTTTCTAAAAGGCTGTGTATCACAAGGGAAAAGTTATGAAGAAGCCCTAAGAAATATTAAAGAAGCCATAGAGCTTTATTTGGGAGATTTAGAAGCCGATGAGTTAGCTTTTCTCTCTAAGAAAAATTCTGTAATAGCACCCATTGAGATAGCTTTTGCCTGA |
| Sequence | MLINAVIEKDENGYFAFVPFLKGCVSQGKSYEEALRNIKEAIELYLGDLEADELAFLSKKNSVIAPIEIAFA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23837. Profile Description: HicB_like antitoxin of bacterial toxin-antitoxin system. This family consists of several bacterial HicB related proteins. The function of HicB is unknown although it is thought to be involved in pilus formation. It has been speculated that HicB performs a function antagonistic to that of pili and yet is necessary for invasion of certain niches. |
| Pubmed ID | 9923682 |
| Domain | CDD:420040 |
| Functional Category | Others |
| Uniprot ID | Q9ZKH6 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1615589 | 1615810 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 2 | 108555 | 108794 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 3 | 900416 | 900631 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 4 | 1579776 | 1579994 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 5 | 25819 | 26037 | + | NZ_CP021887.1 | Helicobacter apodemus |
| 6 | 126289 | 126492 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 7 | 1420269 | 1420496 | - | NZ_CP040846.1 | Thermococcus indicus |
| 8 | 619483 | 619689 | - | NC_015320.1 | Archaeoglobus veneficus SNP6 |
++ More..