Result : Q9ZJ67
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec translocon accessory complex subunit YajC |
| NCBI Accession ID | AE001439.1 |
| Organism | Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99) |
| Left | 1596595 |
| Right | 1596888 |
| Strand | + |
| Nucleotide Sequence | ATGGGACAAACTAAAGAAATTATAACGACGCTTTTACCCCTTTTGGTGTTGTTTCTTATTTTTTATTTTTTGATCGTTCGCCCGCAACGCCAACAGCAAAAAAAGCATAAAGAAATGATAGAGGGCTTGACTAAGGGCGATAAAATTGTCACTCAAGGAGGGCTGATCGTTGAAGTGCTTAAAGCGGAAGCGAATTTTTTTAGCGTGAAACTCAATGATGACACCACCGCTAAACTTTCTAAAAACTATGTAGCGTTCAAATTAGACGAAGAAACAACACCCAACAACAACTAA |
| Sequence | MGQTKEIITTLLPLLVLFLIFYFLIVRPQRQQQKKHKEMIEGLTKGDKIVTQGGLIVEVLKAEANFFSVKLNDDTTAKLSKNYVAFKLDEETTPNNN |
| Source of smORF | Swiss-Prot |
| Function | The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex required for protein secretion, insertion of proteins into membranes, and assembly of membrane protein complexes. While the SecYEG complex is essential for assembly of a number of proteins and complexes, the SecDF-YajC-YidC subcomplex facilitates these functions. {ECO:0000250|UniProtKB:P0ADZ7}. |
| Pubmed ID | 9923682 |
| Domain | CDD:412579 |
| Functional Category | Others |
| Uniprot ID | Q9ZJ67 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 74
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 242763 | 243053 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 2 | 822700 | 822990 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 3 | 1602054 | 1602347 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 4 | 462601 | 462915 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 5 | 1202234 | 1202515 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 6 | 1142249 | 1142533 | - | NZ_LS483446.1 | Helicobacter mustelae |
| 7 | 817826 | 818083 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 8 | 899928 | 900197 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 9 | 836992 | 837264 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 10 | 742352 | 742633 | - | NZ_CP021886.1 | Helicobacter apodemus |
| 11 | 296909 | 297151 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 12 | 1714263 | 1714532 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 13 | 1844276 | 1844551 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 14 | 1988710 | 1988964 | - | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 15 | 1809587 | 1809862 | - | NZ_CP053837.1 | Aliarcobacter faecis |
| 16 | 1150853 | 1151101 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 17 | 1664157 | 1664432 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 18 | 715131 | 715403 | + | NZ_CP012541.1 | Campylobacter concisus |
| 19 | 549096 | 549341 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 20 | 687808 | 688086 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 21 | 805533 | 805781 | + | NZ_CP012543.1 | Campylobacter rectus |
| 22 | 1027809 | 1028054 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 23 | 740171 | 740452 | + | NZ_CP059443.1 | Campylobacter fetus |
| 24 | 795788 | 796054 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 25 | 1324665 | 1324913 | - | NZ_CP012544.1 | Campylobacter showae |
| 26 | 273321 | 273572 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 27 | 740112 | 740354 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 28 | 1245285 | 1245530 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 29 | 568545 | 568817 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 30 | 588328 | 588573 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 31 | 1640508 | 1640783 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 32 | 2110359 | 2110598 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 33 | 1573844 | 1574110 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 34 | 493437 | 493703 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 35 | 1831249 | 1831536 | - | NZ_CP063164.1 | Sulfurovum indicum |
| 36 | 1533369 | 1533620 | - | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 37 | 512842 | 513084 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 38 | 1383724 | 1383984 | + | NC_012115.1 | Nautilia profundicola AmH |
| 39 | 1875601 | 1875870 | - | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 40 | 305860 | 306105 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 41 | 1740752 | 1740997 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 42 | 965825 | 966100 | - | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 43 | 458603 | 458875 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 44 | 1282901 | 1283137 | - | NZ_CP053826.1 | Campylobacter curvus |
| 45 | 522389 | 522628 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 46 | 477657 | 477929 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 47 | 483589 | 483831 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 48 | 403947 | 404222 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 49 | 1278313 | 1278588 | - | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 50 | 547849 | 548121 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 51 | 523415 | 523687 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 52 | 594591 | 594893 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 53 | 982182 | 982457 | - | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 54 | 610588 | 610830 | + | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 55 | 1674388 | 1674654 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 56 | 352118 | 352384 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 57 | 1004956 | 1005231 | - | NC_012039.1 | Campylobacter lari RM2100 |
| 58 | 1042378 | 1042653 | - | NZ_CP053825.1 | Campylobacter armoricus |
| 59 | 1096432 | 1096707 | - | NZ_CP053848.1 | Campylobacter ornithocola |
| 60 | 107189 | 107464 | - | NZ_CP063079.1 | Campylobacter peloridis |
| 61 | 571419 | 571661 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 62 | 436974 | 437243 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 63 | 774338 | 774583 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 64 | 411304 | 411555 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 65 | 404676 | 404987 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 66 | 372622 | 372864 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 67 | 681677 | 681949 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 68 | 394979 | 395245 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 69 | 562825 | 563091 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 70 | 576374 | 576649 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 71 | 1072937 | 1073206 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 72 | 631841 | 632110 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 73 | 1002451 | 1002744 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 74 | 547670 | 547942 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008229.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02355.18 | 1.0 | 74 | 813.5 | same-strand | Protein export membrane protein |
| 2 | PF07549.16 | 1.0 | 74 | 1582.0 | same-strand | SecD/SecF GG Motif |
| 3 | PF19931.1 | 0.73 | 54 | 2589.5 | same-strand | Family of unknown function (DUF6394) |
| 4 | PF13603.8 | 0.65 | 48 | 2904.0 | same-strand | Leucyl-tRNA synthetase, Domain 2 |
++ More..