| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin ParD |
| NCBI Accession ID | |
| Organism | Yersinia pestis |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKDTSV |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the effect of toxin ParE (By similarity). {ECO:0000250}. |
| Pubmed ID | 9746557 11586360 15368893 |
| Domain | CDD:419885,CDD:425357 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | Q9ZGW3 |
| ORF Length (Amino Acid) | 80 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2645866 | 2646108 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 2 | 8753 | 8995 | + | NZ_CP017185.1 | Enterobacter roggenkampii |
| 3 | 1073234 | 1073476 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 4 | 826535 | 826777 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 5 | 591928 | 592170 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05016.17 | 1.0 | 5 | -7 | same-strand | ParE toxin of type II toxin-antitoxin system, parDE |
| 2 | PF01402.23 | 0.6 | 3 | 4505 | opposite-strand | Ribbon-helix-helix protein, copG family |