| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RP024 |
| NCBI Accession ID | AJ235270.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 23165 |
| Right | 23413 |
| Strand | - |
| Nucleotide Sequence | ATGAATACAGAAAAACTAAAAGATATAAAAGCAAGAATTAAAGACTTTAAAAGTTATAAAACTTCTAATTCTAAGATTCAGCAAAAAATTAACCCATTCAGTATCGCTTTAGATTTAGTTTCAGGTACAATGGTAGGGCTCTTAATTGGAATATTAACTGATAAGTTCTTTAATTCTAAACCTTTATTTCTTATTATATTTACAATAATAGGAATGATTGCTGGATTTAACATTATAAGACGAAAGTAA |
| Sequence | MNTEKLKDIKARIKDFKSYKTSNSKIQQKINPFSIALDLVSGTMVGLLIGILTDKFFNSKPLFLIIFTIIGMIAGFNIIRRK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09754. Profile Description: Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter. This model represents a protein found encoded in F1F0-ATPase operons in several genomes, including Methanosarcina barkeri (archaeal) and Chlorobium tepidum (bacterial). It is a small protein (about 100 amino acids) with long hydrophic stretches and is presumed to be a subunit of the enzyme. [Energy metabolism, ATP-proton motive force interconversion] |
| Pubmed ID | 9823893 |
| Domain | CDD:415734 |
| Functional Category | Others |
| Uniprot ID | Q9ZEC0 |
| ORF Length (Amino Acid) | 82 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 23179 | 23427 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 139126 | 139374 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 3 | 295052 | 295315 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 4 | 34211 | 34468 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 5 | 31534 | 31797 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 6 | 31578 | 31841 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 7 | 30839 | 31102 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 8 | 28331 | 28594 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 9 | 35325 | 35588 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 10 | 23999 | 24262 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 11 | 49531 | 49788 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 12 | 1391452 | 1391715 | + | NC_007940.1 | Rickettsia bellii RML369-C |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00430.20 | 1.0 | 12 | 1478 | same-strand | ATP synthase B/B' CF(0) |
| 2 | PF05405.16 | 0.92 | 11 | 1478.5 | same-strand | Mitochondrial ATP synthase B chain precursor (ATP-synt B) |
| 3 | PF02326.17 | 1.0 | 12 | 1154.5 | same-strand | Plant ATP synthase F0 |
| 4 | PF00137.23 | 1.0 | 12 | 912.0 | same-strand | ATP synthase subunit C |
| 5 | PF00119.22 | 1.0 | 12 | 5.0 | same-strand | ATP synthase A chain |
| 6 | PF13462.8 | 1.0 | 12 | 111.0 | same-strand | Thioredoxin |
| 7 | PF02559.18 | 1.0 | 12 | 1109.0 | opposite-strand | CarD-like/TRCF domain |
| 8 | PF10119.11 | 0.92 | 11 | 1876 | same-strand | Predicted methyltransferase regulatory domain |
| 9 | PF08242.14 | 0.92 | 11 | 1876 | same-strand | Methyltransferase domain |
| 10 | PF13649.8 | 0.92 | 11 | 1876 | same-strand | Methyltransferase domain |
| 11 | PF08241.14 | 0.92 | 11 | 1876 | same-strand | Methyltransferase domain |
| 12 | PF02463.21 | 0.83 | 10 | 3887.5 | same-strand | RecF/RecN/SMC N terminal domain |
| 13 | PF13476.8 | 0.83 | 10 | 3887.5 | same-strand | AAA domain |