Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein RP024 |
NCBI Accession ID | AJ235270.1 |
Organism | Rickettsia prowazekii (strain Madrid E) |
Left | 23165 |
Right | 23413 |
Strand | - |
Nucleotide Sequence | ATGAATACAGAAAAACTAAAAGATATAAAAGCAAGAATTAAAGACTTTAAAAGTTATAAAACTTCTAATTCTAAGATTCAGCAAAAAATTAACCCATTCAGTATCGCTTTAGATTTAGTTTCAGGTACAATGGTAGGGCTCTTAATTGGAATATTAACTGATAAGTTCTTTAATTCTAAACCTTTATTTCTTATTATATTTACAATAATAGGAATGATTGCTGGATTTAACATTATAAGACGAAAGTAA |
Sequence | MNTEKLKDIKARIKDFKSYKTSNSKIQQKINPFSIALDLVSGTMVGLLIGILTDKFFNSKPLFLIIFTIIGMIAGFNIIRRK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl09754. Profile Description: Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter. This model represents a protein found encoded in F1F0-ATPase operons in several genomes, including Methanosarcina barkeri (archaeal) and Chlorobium tepidum (bacterial). It is a small protein (about 100 amino acids) with long hydrophic stretches and is presumed to be a subunit of the enzyme. [Energy metabolism, ATP-proton motive force interconversion] |
Pubmed ID | 9823893 |
Domain | CDD:415734 |
Functional Category | Others |
Uniprot ID | Q9ZEC0 |
ORF Length (Amino Acid) | 82 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 23179 | 23427 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
2 | 139126 | 139374 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
3 | 295052 | 295315 | + | NZ_LN794217.1 | Rickettsia monacensis |
4 | 34211 | 34468 | + | NC_009881.1 | Rickettsia akari str. Hartford |
5 | 31534 | 31797 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
6 | 31578 | 31841 | - | NC_016639.1 | Rickettsia slovaca 13-B |
7 | 30839 | 31102 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
8 | 28331 | 28594 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
9 | 35325 | 35588 | - | NZ_AP019563.1 | Rickettsia asiatica |
10 | 23999 | 24262 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
11 | 49531 | 49788 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
12 | 1391452 | 1391715 | + | NC_007940.1 | Rickettsia bellii RML369-C |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00430.20 | 1.0 | 12 | 1478 | same-strand | ATP synthase B/B' CF(0) |
2 | PF05405.16 | 0.92 | 11 | 1478.5 | same-strand | Mitochondrial ATP synthase B chain precursor (ATP-synt B) |
3 | PF02326.17 | 1.0 | 12 | 1154.5 | same-strand | Plant ATP synthase F0 |
4 | PF00137.23 | 1.0 | 12 | 912.0 | same-strand | ATP synthase subunit C |
5 | PF00119.22 | 1.0 | 12 | 5.0 | same-strand | ATP synthase A chain |
6 | PF13462.8 | 1.0 | 12 | 111.0 | same-strand | Thioredoxin |
7 | PF02559.18 | 1.0 | 12 | 1109.0 | opposite-strand | CarD-like/TRCF domain |
8 | PF10119.11 | 0.92 | 11 | 1876 | same-strand | Predicted methyltransferase regulatory domain |
9 | PF08242.14 | 0.92 | 11 | 1876 | same-strand | Methyltransferase domain |
10 | PF13649.8 | 0.92 | 11 | 1876 | same-strand | Methyltransferase domain |
11 | PF08241.14 | 0.92 | 11 | 1876 | same-strand | Methyltransferase domain |
12 | PF02463.21 | 0.83 | 10 | 3887.5 | same-strand | RecF/RecN/SMC N terminal domain |
13 | PF13476.8 | 0.83 | 10 | 3887.5 | same-strand | AAA domain |