Result : Q9ZE85
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RP061 |
| NCBI Accession ID | AJ235270.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 68678 |
| Right | 68932 |
| Strand | + |
| Nucleotide Sequence | ATGATCTTTTTTTTTATTATTAAAAAATTAAAAACAATAAAAGCATCTTTTATTAAGTCGTTTTTTATAAAAGATATAGATGAGTCATTAGAAACAGAACAAATAAATTTTTATTTAAAAAGGATTATTAACCTAGAGGGTTATTATTATGGTAATTATGATTTAACAACAATAAAAGAAAAATATTATACGCTAATAATTAATAATGCCTTCATAGAAAATGAAATAGTACCTGATTTAATAGAGAAACACTAA |
| Sequence | MIFFFIIKKLKTIKASFIKSFFIKDIDESLETEQINFYLKRIINLEGYYYGNYDLTTIKEKYYTLIINNAFIENEIVPDLIEKH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10878. Profile Description: Protein of unknown function (DUF2672). This family of proteins with unknown function appear to be restricted to Rickettsiae. |
| Pubmed ID | 9823893 |
| Domain | CDD:313952 |
| Functional Category | Others |
| Uniprot ID | Q9ZE85 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 68675 | 68944 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 93161 | 93430 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017049.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01134.24 | 1.0 | 2 | 4056.5 | same-strand | Glucose inhibited division protein A |
| 2 | PF13932.8 | 1.0 | 2 | 4056.5 | same-strand | tRNA modifying enzyme MnmG/GidA C-terminal domain |
| 3 | PF02527.17 | 1.0 | 2 | 3497.5 | same-strand | rRNA small subunit methyltransferase G |
| 4 | PF13614.8 | 1.0 | 2 | 2733.5 | same-strand | AAA domain |
| 5 | PF01656.25 | 1.0 | 2 | 2733.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 6 | PF02195.20 | 1.0 | 2 | 1886.5 | same-strand | ParB-like nuclease domain |
| 7 | PF17762.3 | 1.0 | 2 | 1886.5 | same-strand | HTH domain found in ParB protein |
| 8 | PF00005.29 | 1.0 | 2 | 45.0 | same-strand | ABC transporter |
| 9 | PF12848.9 | 1.0 | 2 | 45.0 | same-strand | ABC transporter |
| 10 | PF00793.22 | 1.0 | 2 | 35.5 | same-strand | DAHP synthetase I family |
| 11 | PF01521.22 | 1.0 | 2 | 2332.0 | opposite-strand | Iron-sulphur cluster biosynthesis |
| 12 | PF13286.8 | 1.0 | 2 | 2916.5 | same-strand | Phosphohydrolase-associated domain |
| 13 | PF01966.24 | 1.0 | 2 | 2916.5 | same-strand | HD domain |
| 14 | PF05746.17 | 1.0 | 2 | 4078.0 | same-strand | DALR anticodon binding domain |
| 15 | PF03485.18 | 1.0 | 2 | 4078.0 | same-strand | Arginyl tRNA synthetase N terminal domain |
| 16 | PF05036.15 | 1.0 | 2 | 5875.0 | same-strand | SPOR domain |
++ More..