Result : Q9ZE49
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RP098 |
| NCBI Accession ID | AJ235270.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 109367 |
| Right | 109618 |
| Strand | + |
| Nucleotide Sequence | ATGTTTAAGCACGTATTATTAAGTATAATAATATTTCTAGGTATAAATCAAAATGTTTATTCTATAAACTCTAACTCTTATAAAACAGATGATATAATCAAAATAGTCATTATTCTTGGAATAGTTATTTTAATTTTTAGTCCTGCAAAGTTCCGTATAATTGTTATCGGTACTATATTAGGTTTGGCTTGTGCCTATTTTACTTATAAATACATTATACCTATTTTTATAGCTTCACTAAATGCAGCATAA |
| Sequence | MFKHVLLSIIIFLGINQNVYSINSNSYKTDDIIKIVIILGIVILIFSPAKFRIIVIGTILGLACAYFTYKYIIPIFIASLNAA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17629. Profile Description: Family of unknown function (DUF5510). This is a family of unknown function found in Rickettsia. Family members are predicted to have 2 or 3 trans-membrane regions. |
| Pubmed ID | 9823893 |
| Domain | CDD:340344 |
| Functional Category | Others |
| Uniprot ID | Q9ZE49 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 107566 | 107817 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 26427 | 26675 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 3 | 51017 | 51268 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 4 | 247751 | 247999 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 5 | 113754 | 114002 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 6 | 133892 | 134140 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 7 | 131787 | 132035 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 8 | 1439603 | 1439851 | + | NC_007940.1 | Rickettsia bellii RML369-C |
| 9 | 129043 | 129291 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 10 | 126496 | 126744 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 11 | 129780 | 130028 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 12 | 109519 | 109767 | + | NC_016929.1 | Rickettsia canadensis str. CA410 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017049.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01168.22 | 1.0 | 12 | 1845.5 | same-strand | Alanine racemase, N-terminal domain |
| 2 | PF00842.23 | 1.0 | 12 | 1845.5 | same-strand | Alanine racemase, C-terminal domain |
| 3 | PF02405.18 | 1.0 | 12 | 858.0 | same-strand | Permease MlaE |
| 4 | PF00005.29 | 0.92 | 11 | 2 | same-strand | ABC transporter |
| 5 | PF00830.21 | 0.67 | 8 | 79.5 | same-strand | Ribosomal L28 family |
++ More..