Result : Q9ZE04
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RP158 |
| NCBI Accession ID | AJ235270.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 188020 |
| Right | 188223 |
| Strand | + |
| Nucleotide Sequence | ATGCAAAATCCAACACAAAAAGTTATATCTTTTTCAGAGCATAAAGCTGATATAGAACGCATCAAGAAAGAAATAGAAGAAGGGTGGGCAATAGTAAAGCTAGTTCCTAATAAAGACCGTTTCATTGGACTTTTAGAAAAGATTTCGGATCCTAAAGATGAAACAATTTATATTCCTCCAAGAAAAAAGATCATAATGAATTAA |
| Sequence | MQNPTQKVISFSEHKADIERIKKEIEEGWAIVKLVPNKDRFIGLLEKISDPKDETIYIPPRKKIIMN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10879. Profile Description: Protein of unknown function (DUF2674). This family of proteins with unknown function appears to be conserved to Rickettsia spp. |
| Pubmed ID | 9823893 |
| Domain | CDD:402471 |
| Functional Category | Others |
| Uniprot ID | Q9ZE04 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 186220 | 186423 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 572918 | 573121 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 3 | 210532 | 210735 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 4 | 208063 | 208266 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 5 | 211621 | 211824 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 6 | 212760 | 212963 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 7 | 185835 | 186038 | + | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 8 | 240462 | 240665 | + | NZ_AP019563.1 | Rickettsia asiatica |
| 9 | 1242470 | 1242673 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 10 | 188780 | 188983 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 11 | 1212809 | 1213015 | - | NC_007940.1 | Rickettsia bellii RML369-C |
| 12 | 213859 | 214062 | + | NC_009881.1 | Rickettsia akari str. Hartford |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017049.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01765.21 | 0.75 | 9 | 3083 | opposite-strand | Ribosome recycling factor |
| 2 | PF00696.30 | 0.92 | 11 | 2104 | opposite-strand | Amino acid kinase family |
| 3 | PF07690.18 | 0.75 | 9 | 231 | opposite-strand | Major Facilitator Superfamily |
| 4 | PF07244.17 | 0.83 | 10 | 1904.0 | opposite-strand | Surface antigen variable number repeat |
| 5 | PF01103.25 | 0.83 | 10 | 1904.0 | opposite-strand | Omp85 superfamily domain |
| 6 | PF02163.24 | 0.92 | 11 | 4449 | opposite-strand | Peptidase family M50 |
| 7 | PF17820.3 | 0.83 | 10 | 4450.0 | opposite-strand | PDZ domain |
| 8 | PF01029.20 | 0.67 | 8 | 4925.5 | same-strand | NusB family |
++ More..