Result : Q9ZDZ9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RP164 |
| NCBI Accession ID | AJ235270.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 195404 |
| Right | 195529 |
| Strand | - |
| Nucleotide Sequence | GTGGAATTTTGTACTAACACTATTGATACTATTTCATATACAACTCATGAAAGTATAGAAGAACCTAACCTAAAGGAAAAGGATATTGAGGACGATTTAGTAGTAGTATCTCTAATTGGGAACTAA |
| Sequence | MEFCTNTIDTISYTTHESIEEPNLKEKDIEDDLVVVSLIGN |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9823893 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9ZDZ9 |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 193605 | 193730 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 196185 | 196310 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017049.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07244.17 | 1.0 | 2 | 3711.5 | same-strand | Surface antigen variable number repeat |
| 2 | PF01103.25 | 1.0 | 2 | 3711.5 | same-strand | Omp85 superfamily domain |
| 3 | PF02163.24 | 1.0 | 2 | 2408.0 | same-strand | Peptidase family M50 |
| 4 | PF17820.3 | 1.0 | 2 | 2408.0 | same-strand | PDZ domain |
| 5 | PF01029.20 | 1.0 | 2 | 1744.0 | opposite-strand | NusB family |
| 6 | PF01728.21 | 1.0 | 2 | 1064.0 | opposite-strand | FtsJ-like methyltransferase |
| 7 | PF03364.22 | 1.0 | 2 | 1265.5 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 8 | PF04452.16 | 1.0 | 2 | 2003.0 | opposite-strand | RNA methyltransferase |
| 9 | PF04070.14 | 1.0 | 2 | 2790.5 | same-strand | Domain of unknown function (DUF378) |
++ More..