Result : Q9ZDZ4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RP169 |
| NCBI Accession ID | AJ235270.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 198309 |
| Right | 198581 |
| Strand | - |
| Nucleotide Sequence | ATGATTATTTTACATTTAATTCACAGGAGTTTAAATATGTTAATAAATACTTCTAATAATCTTCTTATTACTACTATACATTTATTATCTTCCATAGGAGCTATAAATTGGGGTTTAGTTGGGTTATTTAATTTTAATTTAGTTACACTTTTATTTGGCTCATTTCCAATTATTGTTACAATATTTTATATAATAATAGGCTTTTGTGGTGTATATTCTTTCTTATATTTAGGTAAGATATTTTGTAAACCAGGAATAAAAAACGTAAAATAA |
| Sequence | MIILHLIHRSLNMLINTSNNLLITTIHLLSSIGAINWGLVGLFNFNLVTLLFGSFPIIVTIFYIIIGFCGVYSFLYLGKIFCKPGIKNVK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00943. Profile Description: Domain of unknown function (DUF378). Predicted transmembrane domain of unknown function. The majority of the family have two predicted transmembrane regions. |
| Pubmed ID | 9823893 |
| Domain | CDD:412664 |
| Functional Category | Others |
| Uniprot ID | Q9ZDZ4 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 196511 | 196783 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 199110 | 199382 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 3 | 221669 | 221905 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 4 | 1241805 | 1242041 | + | NC_007940.1 | Rickettsia bellii RML369-C |
| 5 | 223902 | 224138 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 6 | 222677 | 222913 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 7 | 577661 | 577891 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 8 | 1231118 | 1231354 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017049.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03364.22 | 0.88 | 7 | 1114 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 2 | PF04452.16 | 0.88 | 7 | 89 | opposite-strand | RNA methyltransferase |
| 3 | PF00873.21 | 0.88 | 7 | 133 | same-strand | AcrB/AcrD/AcrF family |
| 4 | PF00216.23 | 0.88 | 7 | 3606 | opposite-strand | Bacterial DNA-binding protein |
| 5 | PF00448.24 | 0.88 | 7 | 5249 | opposite-strand | SRP54-type protein, GTPase domain |
| 6 | PF02978.21 | 0.88 | 7 | 5249 | opposite-strand | Signal peptide binding domain |
| 7 | PF02881.21 | 0.88 | 7 | 5249 | opposite-strand | SRP54-type protein, helical bundle domain |
++ More..