Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein RP215 |
NCBI Accession ID | AJ235270.1 |
Organism | Rickettsia prowazekii (strain Madrid E) |
Left | 267320 |
Right | 267592 |
Strand | + |
Nucleotide Sequence | ATGCAAGAAAAAGAATTATCTAATAATTTTTTAGAAGAACAAAACACGTTTAAGGAAGATAATTCGCCGTTCTCTGATATAAAGTATATTTGTCAAGCAAGCTTATTAATTACAGATTCTATTAGAAAAGGGTATGATGTAACTCAATTGTCCAATGGTGATATTAATGTTACAGAAATAAGAATAGTAAATGTTCATTATAATTGGAACTCCGAAAAAGGGAAATTTGTTAAAACTAATCAGATAGAATTTAATAATAACAAAGGTGGATAA |
Sequence | MQEKELSNNFLEEQNTFKEDNSPFSDIKYICQASLLITDSIRKGYDVTQLSNGDINVTEIRIVNVHYNWNSEKGKFVKTNQIEFNNNKGG |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam10877. Profile Description: Protein of unknown function (DUF2671). This family of proteins with unknown function appears to be restricted to Rickettsia spp. |
Pubmed ID | 9823893 |
Domain | CDD:402470 |
Functional Category | Others |
Uniprot ID | Q9ZDV4 |
ORF Length (Amino Acid) | 90 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 265530 | 265802 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
2 | 291606 | 291878 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
3 | 581986 | 582258 | - | NC_007940.1 | Rickettsia bellii RML369-C |
4 | 296039 | 296311 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
5 | 296908 | 297180 | + | NC_016639.1 | Rickettsia slovaca 13-B |
6 | 1151906 | 1152178 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
7 | 51201 | 51473 | - | NZ_LN794217.1 | Rickettsia monacensis |
8 | 297462 | 297731 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
9 | 264785 | 265054 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
10 | 328735 | 329007 | + | NZ_AP019563.1 | Rickettsia asiatica |
11 | 298188 | 298469 | + | NC_009881.1 | Rickettsia akari str. Hartford |
12 | 278167 | 278439 | + | NC_016929.1 | Rickettsia canadensis str. CA410 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02547.17 | 0.67 | 8 | 3290.0 | opposite-strand | Queuosine biosynthesis protein |
2 | PF00005.29 | 1.0 | 12 | 181.0 | opposite-strand | ABC transporter |
3 | PF00664.25 | 1.0 | 12 | 181.0 | opposite-strand | ABC transporter transmembrane region |
4 | PF01654.19 | 1.0 | 12 | 169.0 | same-strand | Cytochrome bd terminal oxidase subunit I |
5 | PF02322.17 | 0.92 | 11 | 1590 | same-strand | Cytochrome bd terminal oxidase subunit II |
6 | PF13704.8 | 1.0 | 12 | 3186.5 | same-strand | Glycosyl transferase family 2 |