Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein RP244 |
NCBI Accession ID | AJ235271.1 |
Organism | Rickettsia prowazekii (strain Madrid E) |
Left | 19156 |
Right | 19362 |
Strand | - |
Nucleotide Sequence | ATGAAAACAAATAATATTTTAAAGGTAGCAGTTGGAGCTAGTAGTGTAGCACAAAAAGCCCTAAACAGTATAGCAAATAAAGGCTATAACTTCATTGAAGATAAAATACTTAAAGGTAATTACATTAGTCGCGAAGAATTTGAAAAATTACAAACTTTAGTAATAAAACTAAAAAAAGAATTAACAGAGTTAAAGGGTAATAATTAA |
Sequence | MKTNNILKVAVGASSVAQKALNSIANKGYNFIEDKILKGNYISREEFEKLQTLVIKLKKELTELKGNN |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9823893 |
Domain | |
Functional Category | Others |
Uniprot ID | Q9ZDT1 |
ORF Length (Amino Acid) | 68 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 299910 | 300116 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
2 | 300003 | 300206 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
3 | 1115305 | 1115508 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
4 | 648187 | 648390 | - | NZ_LN794217.1 | Rickettsia monacensis |
5 | 333692 | 333895 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
6 | 329642 | 329845 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
7 | 335013 | 335216 | - | NC_016639.1 | Rickettsia slovaca 13-B |
8 | 335968 | 336171 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
9 | 368725 | 368928 | - | NZ_AP019563.1 | Rickettsia asiatica |
10 | 315276 | 315482 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
11 | 333681 | 333884 | - | NC_009881.1 | Rickettsia akari str. Hartford |
12 | 1062097 | 1062297 | + | NC_007940.1 | Rickettsia bellii RML369-C |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF11020.10 | 0.83 | 10 | 3391.5 | opposite-strand | Domain of unknown function (DUF2610) |
2 | PF02666.17 | 0.83 | 10 | 2662.5 | opposite-strand | Phosphatidylserine decarboxylase |
3 | PF01066.23 | 0.92 | 11 | 1717 | opposite-strand | CDP-alcohol phosphatidyltransferase |
4 | PF08009.13 | 0.92 | 11 | 1717 | opposite-strand | CDP-alcohol phosphatidyltransferase 2 |
5 | PF00529.22 | 0.83 | 10 | 734.0 | opposite-strand | Cation efflux system protein CusB domain 1 |
6 | PF13533.8 | 0.83 | 10 | 637.0 | opposite-strand | Biotin-lipoyl like |
7 | PF01722.20 | 1.0 | 12 | -3.0 | same-strand | BolA-like protein |
8 | PF00563.22 | 1.0 | 12 | 294.0 | opposite-strand | EAL domain |
9 | PF01225.27 | 1.0 | 12 | 1712.0 | opposite-strand | Mur ligase family, catalytic domain |
10 | PF08245.14 | 1.0 | 12 | 1712.0 | opposite-strand | Mur ligase middle domain |
11 | PF02875.23 | 1.0 | 12 | 1712.0 | opposite-strand | Mur ligase family, glutamate ligase domain |
12 | PF02873.18 | 1.0 | 12 | 3157.5 | opposite-strand | UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain |
13 | PF01565.25 | 1.0 | 12 | 3157.5 | opposite-strand | FAD binding domain |
14 | PF07478.15 | 1.0 | 12 | 4194.0 | opposite-strand | D-ala D-ala ligase C-terminus |
15 | PF01820.23 | 0.67 | 8 | 4320.5 | opposite-strand | D-ala D-ala ligase N-terminus |
16 | PF13535.8 | 1.0 | 12 | 4194.0 | opposite-strand | ATP-grasp domain |
17 | PF02655.16 | 1.0 | 12 | 4194.0 | opposite-strand | ATP-grasp domain |