| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RP288 |
| NCBI Accession ID | AJ235271.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 71129 |
| Right | 71308 |
| Strand | + |
| Nucleotide Sequence | ATGTTAAAATCATTAAAGTTTCTATTAGTATTCATTATTCTTGCTCAATTGTTGTCATGTACACCTTCAGCTCCTTATGAAATTAAAAGTCCGTGCGTTTCTGTTGATATAGATGATAATTCGAGTTTAAGCATAAATCCTTGTATAAGAAGACCGATTAATGCAGTAAATATAGTATAA |
| Sequence | MLKSLKFLLVFIILAQLLSCTPSAPYEIKSPCVSVDIDDNSSLSINPCIRRPINAVNIV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10913. Profile Description: Protein of unknown function (DUF2706). This family of proteins with unknown function appears to be restricted to Rickettsia spp. |
| Pubmed ID | 9823893 |
| Domain | CDD:313971 |
| Functional Category | Others |
| Uniprot ID | Q9ZDN9 |
| ORF Length (Amino Acid) | 59 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 351881 | 352060 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 353453 | 353632 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 3 | 392858 | 393037 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 4 | 1268872 | 1269051 | - | NZ_LN794217.1 | Rickettsia monacensis |
| 5 | 384210 | 384389 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 6 | 801889 | 802068 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 7 | 842697 | 842876 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 8 | 1064530 | 1064709 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 9 | 1112429 | 1112611 | + | NC_007940.1 | Rickettsia bellii RML369-C |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00361.22 | 1.0 | 9 | 2674 | opposite-strand | Proton-conducting membrane transporter |
| 2 | PF00420.26 | 1.0 | 9 | 2075 | opposite-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 4L |
| 3 | PF03524.17 | 1.0 | 9 | 1161 | opposite-strand | Conjugal transfer protein |
| 4 | PF04335.15 | 1.0 | 9 | 208.0 | both-strands | VirB8 protein |
| 5 | PF03743.16 | 1.0 | 9 | 1381 | same-strand | Bacterial conjugation TrbI-like protein |
| 6 | PF00437.22 | 1.0 | 9 | 2826 | same-strand | Type II/IV secretion system protein |
| 7 | PF02534.16 | 1.0 | 9 | 4025 | same-strand | Type IV secretory system Conjugative DNA transfer |
| 8 | PF12696.9 | 1.0 | 9 | 4025 | same-strand | TraM recognition site of TraD and TraG |