Result : Q9ZDH8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | AJ235271.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 149175 |
| Right | 149417 |
| Strand | + |
| Nucleotide Sequence | ATGACTAATACTAAAACTTTAAAAGACAATATTAGCTTTGAAGAAGCTTTAAGAGAGCTTGAGGAAATTGTAAAAAAAATAGATACTGGACAAGAGAATCTAGAGACGGCAGTTAATAGTTTTGAAAGGGGTATTTTACTTAAGAATCATTGTGAAAAAAAATTAAAAGAAGCTCGATTAAAAATTGAAAAAATTACTAAACTTGCTGATTCTACAGTGATCTTAGAAGAGACAGAAGTGTAG |
| Sequence | MTNTKTLKDNISFEEALRELEEIVKKIDTGQENLETAVNSFERGILLKNHCEKKLKEARLKIEKITKLADSTVILEETEV |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000250}. |
| Pubmed ID | 9823893 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q9ZDH8 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 429908 | 430150 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 432823 | 433065 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 3 | 751748 | 751990 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 4 | 706794 | 707036 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 5 | 477579 | 477821 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 6 | 1184757 | 1184999 | - | NZ_LN794217.1 | Rickettsia monacensis |
| 7 | 480960 | 481202 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 8 | 843001 | 843243 | - | NC_007940.1 | Rickettsia bellii RML369-C |
| 9 | 474190 | 474432 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 10 | 479773 | 480015 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 11 | 476738 | 476980 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 12 | 967369 | 967611 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 13 | 1441077 | 1441331 | - | NZ_CP014525.1 | Haematospirillum jordaniae |
| 14 | 796177 | 796371 | - | NC_016026.1 | Micavibrio aeruginosavorus ARL-13 |
| 15 | 3045807 | 3046004 | + | NC_017584.1 | Rhodospirillum rubrum F11 |
| 16 | 1791940 | 1792182 | - | NZ_CP029479.1 | Phenylobacterium parvum |
| 17 | 2308196 | 2308450 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017049.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01782.20 | 0.71 | 12 | 2707.0 | opposite-strand | RimM N-terminal domain |
| 2 | PF13502.8 | 0.71 | 12 | 14.0 | same-strand | AsmA-like C-terminal region |
++ More..