Result : Q9ZDH6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RP352 |
| NCBI Accession ID | AJ235271.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 151004 |
| Right | 151135 |
| Strand | + |
| Nucleotide Sequence | ATGATTCTTCTAAAGGTAAACCATAAGCCTTTTATGCTACCATGTGTTGTTATAGCTTCTTTAGCATATTCTGAACAAGTAGGGTGGAATAGGCAATTATTACCAAGTAGCGGAGAAATAAAATATTTATAG |
| Sequence | MILLKVNHKPFMLPCVVIASLAYSEQVGWNRQLLPSSGEIKYL |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9823893 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9ZDH6 |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 431737 | 431868 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 704720 | 704848 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 3 | 877413 | 877541 | - | NZ_LN794217.1 | Rickettsia monacensis |
| 4 | 394246 | 394386 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 5 | 4477167 | 4477292 | + | NZ_CP046670.1 | Alteromonas mediterranea |
| 6 | 4514358 | 4514465 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 7 | 4738983 | 4739105 | + | NZ_CP003915.1 | Advenella mimigardefordensis DPN7 |
| 8 | 3213857 | 3213976 | + | NZ_CP029347.1 | Saliniradius amylolyticus |
| 9 | 2414689 | 2414811 | - | NZ_CP059564.1 | Alysiella filiformis |
| 10 | 303707 | 303829 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 11 | 4026731 | 4026850 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 12 | 737728 | 737847 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 13 | 2770789 | 2770908 | - | NC_014033.1 | Prevotella ruminicola 23 |
| 14 | 2552457 | 2552585 | + | NZ_CP042218.1 | Luteimonas granuli |
| 15 | 360068 | 360175 | + | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 16 | 3361099 | 3361224 | + | NZ_AP021881.1 | Sulfuriferula nivalis |
| 17 | 669725 | 669874 | + | NC_015501.1 | Porphyromonas asaccharolytica DSM 20707 |
| 18 | 3129562 | 3129678 | + | NZ_CP028901.1 | Algicoccus marinus |
| 19 | 1579406 | 1579531 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 20 | 3825553 | 3825672 | + | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 21 | 2968083 | 2968208 | + | NZ_CP032869.1 | Mucilaginibacter celer |
| 22 | 1335702 | 1335833 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 23 | 4170910 | 4171032 | + | NZ_CP012621.1 | Zobellella denitrificans |
| 24 | 5072911 | 5073027 | + | NZ_CP014955.1 | Mycobacteroides abscessus |
| 25 | 5028553 | 5028669 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 26 | 403286 | 403411 | - | NZ_CP039456.1 | Changchengzhania lutea |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017049.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01809.20 | 0.73 | 19 | -122 | opposite-strand | Putative membrane protein insertion efficiency factor |
++ More..