Result : B0BUQ8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CP000766.3 |
| Organism | Rickettsia rickettsii (strain Iowa) |
| Left | 940206 |
| Right | 940502 |
| Strand | - |
| Nucleotide Sequence | ATGAGTGCTTATAAATACTACGATTTAATTAGAAAACCTATTATTACAGAAAAAACTACAACCCTTTCGGAACAAAATAAATACGCTTTTTATGTAGATAAATTTGCTGAAAAACTTACCCTTAAAAAGGCTATAGAAGAAATATTTAAAGTAAAAGTAAAAAAAGTGAATATTTTAAACGTTAAAGGTAAGAAGAAAAGATTTAAAGGAATTATAGGGACTCAAATCAATAGAAAGAAAGCTATTGTTACATTAGAAAAAGACCATAATATCGATTTTGCCGGAGGAATTAAATAA |
| Sequence | MSAYKYYDLIRKPIITEKTTTLSEQNKYAFYVDKFAEKLTLKKAIEEIFKVKVKKVNILNVKGKKKRFKGIIGTQINRKKAIVTLEKDHNIDFAGGIK |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 18025092 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B0BUQ8 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 242
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 940206 | 940502 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 2 | 1295202 | 1295498 | - | NZ_LN794217.1 | Rickettsia monacensis |
| 3 | 1000340 | 1000636 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 4 | 948568 | 948864 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 5 | 932218 | 932514 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 6 | 942047 | 942343 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 7 | 911759 | 912055 | - | NC_009881.1 | Rickettsia akari str. Hartford |
| 8 | 866935 | 867231 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 9 | 816274 | 816570 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 10 | 1151868 | 1152164 | - | NC_007940.1 | Rickettsia bellii RML369-C |
| 11 | 826517 | 826813 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 12 | 504385 | 504681 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
| 13 | 1317158 | 1317451 | - | NZ_CP071057.1 | Marinicauda algicola |
| 14 | 2967914 | 2968168 | + | NZ_CP026100.1 | Caulobacter flavus |
| 15 | 5035406 | 5035660 | - | NZ_CP017147.1 | Bosea vaviloviae |
| 16 | 900490 | 900783 | + | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 17 | 1331729 | 1331983 | + | NZ_CP013002.1 | Caulobacter henricii |
| 18 | 3553729 | 3553983 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 19 | 1421030 | 1421332 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 20 | 5154705 | 5154956 | + | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 21 | 4059761 | 4060012 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 22 | 5720164 | 5720415 | + | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 23 | 3024255 | 3024524 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 24 | 1433112 | 1433366 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 25 | 1603129 | 1603383 | + | NZ_CP027850.1 | Caulobacter segnis |
| 26 | 2013044 | 2013337 | + | NZ_CP061205.1 | Kordiimonas pumila |
| 27 | 3424092 | 3424343 | + | NZ_LS398110.1 | Bradyrhizobium vignae |
| 28 | 231408 | 231701 | - | NZ_CP058235.1 | Bartonella alsatica |
| 29 | 977932 | 978225 | - | NC_020300.1 | Bartonella australis Aust/NH1 |
| 30 | 1197997 | 1198290 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 31 | 1482763 | 1483056 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 32 | 1084789 | 1085082 | - | NZ_LR134527.1 | Bartonella elizabethae |
| 33 | 829693 | 829986 | + | NZ_CP031843.2 | Bartonella kosoyi |
| 34 | 1605708 | 1606001 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 35 | 920786 | 921079 | + | NZ_CP010401.1 | Bartonella ancashensis |
| 36 | 3264253 | 3264546 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 37 | 1129797 | 1130051 | + | NZ_CP029479.1 | Phenylobacterium parvum |
| 38 | 2948416 | 2948679 | + | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 39 | 1140042 | 1140335 | - | NZ_HG965802.1 | Bartonella henselae |
| 40 | 1489713 | 1490015 | + | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 41 | 1877751 | 1878005 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 42 | 2870991 | 2871284 | - | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 43 | 3196153 | 3196446 | - | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 44 | 4308615 | 4308908 | - | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 45 | 4145964 | 4146257 | - | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 46 | 4743139 | 4743432 | - | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 47 | 4784457 | 4784750 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 48 | 210913 | 211206 | + | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 49 | 6047105 | 6047398 | + | NZ_CP050296.1 | Mesorhizobium huakuii |
| 50 | 6284419 | 6284670 | - | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 51 | 5593019 | 5593270 | - | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 52 | 2051755 | 2052009 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 53 | 567822 | 568115 | + | NZ_AP019773.1 | Bartonella quintana |
| 54 | 250553 | 250807 | - | NZ_CP022048.2 | Brevundimonas vesicularis |
| 55 | 2501023 | 2501277 | - | NC_015684.1 | Afipia carboxidovorans OM5 |
| 56 | 4195212 | 4195463 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 57 | 3969845 | 3970096 | - | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 58 | 3218578 | 3218889 | - | NZ_CP025086.1 | Methylovirgula ligni |
| 59 | 6123847 | 6124116 | + | NZ_CP044543.1 | Bradyrhizobium betae |
| 60 | 2990195 | 2990464 | + | NC_017082.1 | Bradyrhizobium cosmicum |
| 61 | 5870550 | 5870819 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 62 | 1518498 | 1518752 | + | NC_014217.1 | Starkeya novella DSM 506 |
| 63 | 1242846 | 1243139 | + | NZ_CP030265.1 | Skermanella pratensis |
| 64 | 686833 | 687126 | + | NC_008783.1 | Bartonella bacilliformis KC583 |
| 65 | 712989 | 713282 | + | NC_008783.1 | Bartonella bacilliformis KC583 |
| 66 | 4100217 | 4100486 | - | NZ_CP029553.1 | Methylobacterium terrae |
| 67 | 1801520 | 1801813 | + | NZ_CP021330.1 | Maritalea myrionectae |
| 68 | 4720099 | 4720368 | - | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 69 | 1760475 | 1760744 | + | NC_007964.1 | Nitrobacter hamburgensis X14 |
| 70 | 1532284 | 1532553 | + | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 71 | 5137338 | 5137589 | - | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 72 | 2922607 | 2922900 | - | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 73 | 2468214 | 2468477 | - | NZ_CP045423.1 | Microvirga thermotolerans |
| 74 | 1443037 | 1443306 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 75 | 230706 | 230975 | - | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 76 | 181189 | 181476 | + | NZ_CP034118.1 | Staphylospora marina |
| 77 | 2879634 | 2879903 | - | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 78 | 2597336 | 2597581 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 79 | 158541 | 158837 | + | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 80 | 1533147 | 1533416 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 81 | 2069083 | 2069379 | - | NZ_CP025430.1 | Paracoccus zhejiangensis |
| 82 | 128007 | 128303 | + | NZ_CP032125.1 | Profundibacter amoris |
| 83 | 4391355 | 4391609 | + | NZ_CP021112.1 | Pseudorhodoplanes sinuspersici |
| 84 | 6594835 | 6595131 | - | NZ_CP029550.1 | Methylobacterium durans |
| 85 | 51070 | 51357 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 86 | 1159716 | 1159985 | - | NZ_CP039964.1 | Pseudorhodobacter turbinis |
| 87 | 2552407 | 2552703 | - | NZ_CP003984.1 | Planktomarina temperata RCA23 |
| 88 | 1015906 | 1016193 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 89 | 314539 | 314790 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 90 | 3250460 | 3250753 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 91 | 919242 | 919538 | + | NZ_CP034348.1 | Roseovarius faecimaris |
| 92 | 944587 | 944883 | + | NZ_CP024899.1 | Rhodobaca barguzinensis |
| 93 | 1900591 | 1900869 | + | NZ_CP031555.1 | Thalassospira indica |
| 94 | 2977497 | 2977793 | - | NZ_CP021404.1 | Pacificitalea manganoxidans |
| 95 | 2015822 | 2016076 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 96 | 1268009 | 1268278 | + | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 97 | 2259110 | 2259373 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 98 | 2808099 | 2808395 | + | NZ_CP061498.1 | Roseicitreum antarcticum |
| 99 | 248037 | 248306 | + | NZ_CP012160.1 | Octadecabacter temperatus |
| 100 | 1515070 | 1515324 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 101 | 463179 | 463466 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 102 | 2177093 | 2177389 | - | NZ_CP060436.1 | Pseudooceanicola algae |
| 103 | 771231 | 771527 | + | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
| 104 | 333887 | 334183 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
| 105 | 1783699 | 1783947 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 106 | 233484 | 233738 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 107 | 4172502 | 4172798 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 108 | 4213759 | 4214052 | - | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 109 | 864506 | 864802 | - | NZ_CP015093.1 | Salipiger abyssi |
| 110 | 3439175 | 3439471 | + | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
| 111 | 495623 | 495871 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 112 | 2190992 | 2191261 | - | NZ_CP019937.1 | Ketogulonicigenium robustum |
| 113 | 48694 | 48975 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 114 | 2219841 | 2220131 | - | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 115 | 624999 | 625283 | + | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 116 | 424831 | 425100 | + | NZ_CP012661.1 | Defluviimonas alba |
| 117 | 1921217 | 1921519 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 118 | 249118 | 249414 | + | NZ_CP033219.1 | Parasedimentitalea marina |
| 119 | 817743 | 818030 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 120 | 1002010 | 1002306 | + | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 121 | 944135 | 944374 | - | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 122 | 3837143 | 3837439 | - | NZ_CP053562.1 | Thioclava electrotropha |
| 123 | 170401 | 170691 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 124 | 297591 | 297887 | + | NZ_CP021047.1 | Phaeobacter gallaeciensis |
| 125 | 274358 | 274627 | + | NC_020908.1 | Octadecabacter arcticus 238 |
| 126 | 305569 | 305823 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 127 | 428880 | 429164 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 128 | 3260460 | 3260714 | + | NZ_CP018221.1 | Tardibacter chloracetimidivorans |
| 129 | 241328 | 241579 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 130 | 2600986 | 2601255 | - | NZ_CP012908.1 | Ketogulonicigenium vulgare |
| 131 | 1280690 | 1280995 | - | NZ_CP029476.1 | Lactobacillus apis |
| 132 | 2071902 | 2072189 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 133 | 1452341 | 1452610 | - | NZ_CP012023.1 | Celeribacter marinus |
| 134 | 403509 | 403748 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 135 | 1380496 | 1380807 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 136 | 352031 | 352270 | + | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 137 | 380170 | 380454 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 138 | 154965 | 155222 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 139 | 2225113 | 2225358 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 140 | 3077390 | 3077641 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 141 | 1469768 | 1470079 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 142 | 387613 | 387867 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 143 | 395276 | 395524 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 144 | 398995 | 399282 | + | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 145 | 271418 | 271663 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 146 | 40427 | 40672 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 147 | 1549273 | 1549521 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 148 | 148375 | 148632 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 149 | 2775225 | 2775497 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 150 | 449676 | 449942 | + | NZ_LR215048.1 | Acholeplasma axanthum |
| 151 | 108312 | 108587 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 152 | 699011 | 699307 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 153 | 324025 | 324300 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 154 | 339398 | 339637 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 155 | 1314904 | 1315143 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 156 | 292285 | 292530 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 157 | 355497 | 355745 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 158 | 47589 | 47828 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 159 | 269140 | 269379 | + | NZ_CP034726.1 | Acetilactobacillus jinshanensis |
| 160 | 3762255 | 3762509 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 161 | 1365769 | 1366056 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 162 | 728698 | 728937 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 163 | 1888855 | 1889100 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 164 | 562504 | 562743 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 165 | 1526868 | 1527107 | - | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 166 | 161944 | 162183 | + | NZ_CP015247.1 | Leuconostoc suionicum |
| 167 | 348791 | 349078 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 168 | 790063 | 790350 | + | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 169 | 215307 | 215546 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 170 | 70545 | 70784 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 171 | 1983704 | 1983979 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 172 | 239383 | 239658 | + | NZ_CP047361.1 | Macrococcus canis |
| 173 | 1788646 | 1788903 | + | NZ_CP021434.1 | Tumebacillus avium |
| 174 | 1101164 | 1101451 | - | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 175 | 129688 | 129975 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 176 | 1403454 | 1403693 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 177 | 558708 | 558986 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 178 | 1845263 | 1845502 | + | NZ_CP042410.1 | Leuconostoc citreum |
| 179 | 1669466 | 1669744 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 180 | 1940357 | 1940596 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 181 | 627761 | 628063 | + | NC_014165.1 | Thermobispora bispora DSM 43833 |
| 182 | 140219 | 140512 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 183 | 475735 | 476013 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 184 | 2096916 | 2097203 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 185 | 121222 | 121509 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 186 | 482113 | 482400 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 187 | 3099158 | 3099445 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 188 | 938274 | 938516 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 189 | 322973 | 323215 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 190 | 1279694 | 1279969 | + | NZ_CP027770.1 | Staphylococcus felis |
| 191 | 1980149 | 1980424 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 192 | 651627 | 651902 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 193 | 3265732 | 3266019 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 194 | 236862 | 237101 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 195 | 132232 | 132516 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 196 | 342749 | 343036 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 197 | 1810892 | 1811185 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 198 | 1263527 | 1263766 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 199 | 809737 | 810009 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 200 | 1283631 | 1283870 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 201 | 1966124 | 1966363 | - | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 202 | 1566727 | 1566966 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 203 | 6131390 | 6131683 | - | NZ_AP019400.1 | Cohnella abietis |
| 204 | 1483248 | 1483517 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 205 | 3443591 | 3443881 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 206 | 1716256 | 1716495 | - | NC_018631.1 | Leuconostoc gelidum JB7 |
| 207 | 1789175 | 1789462 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 208 | 59478 | 59765 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 209 | 129309 | 129596 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 210 | 2822961 | 2823248 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 211 | 143739 | 144026 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 212 | 2266765 | 2267052 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 213 | 332033 | 332317 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 214 | 142703 | 142987 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 215 | 1869840 | 1870142 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 216 | 129335 | 129574 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 217 | 4990 | 5301 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 218 | 4046534 | 4046821 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 219 | 198106 | 198393 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 220 | 807972 | 808211 | - | NZ_CP042374.1 | Leuconostoc carnosum |
| 221 | 5702114 | 5702404 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 222 | 251563 | 251847 | + | NZ_CP053989.1 | Niallia circulans |
| 223 | 1318110 | 1318412 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 224 | 5135661 | 5135954 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 225 | 4369137 | 4369394 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 226 | 290850 | 291134 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 227 | 2395730 | 2395969 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 228 | 1194976 | 1195263 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 229 | 166112 | 166396 | + | NZ_AP019827.1 | Leptotrichia shahii |
| 230 | 1717823 | 1718071 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 231 | 1327527 | 1327829 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 232 | 1303923 | 1304225 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 233 | 1283016 | 1283255 | - | NZ_CP037940.1 | Weissella cryptocerci |
| 234 | 5494994 | 5495317 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 235 | 1100071 | 1100322 | + | NZ_CP029684.2 | Oenococcus sicerae |
| 236 | 1782333 | 1782581 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 237 | 1762919 | 1763167 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 238 | 56614 | 56862 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 239 | 2167442 | 2167738 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 240 | 1825868 | 1826110 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 241 | 1172413 | 1172661 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 242 | 92755 | 92994 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 243 | 1134479 | 1134775 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP071057.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00252.20 | 0.96 | 232 | 2267 | same-strand | Ribosomal protein L16p/L10e |
| 2 | PF00189.22 | 0.97 | 235 | 1552.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 3 | PF07650.19 | 0.97 | 235 | 1552.0 | same-strand | KH domain |
| 4 | PF00237.21 | 0.98 | 236 | 1177 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00203.23 | 0.98 | 238 | 878 | same-strand | Ribosomal protein S19 |
| 6 | PF03947.20 | 0.98 | 238 | 23 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 7 | PF00181.25 | 0.98 | 238 | 23 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 8 | PF00573.24 | 1.0 | 242 | 0 | same-strand | Ribosomal protein L4/L1 family |
| 9 | PF00338.24 | 0.99 | 239 | 1381.5 | same-strand | Ribosomal protein S10p/S20e |
| 10 | PF00009.29 | 0.75 | 182 | 2089 | same-strand | Elongation factor Tu GTP binding domain |
| 11 | PF03143.19 | 0.65 | 157 | 1863.0 | same-strand | Elongation factor Tu C-terminal domain |
| 12 | PF03144.27 | 0.75 | 182 | 2090.5 | same-strand | Elongation factor Tu domain 2 |
| 13 | PF01926.25 | 0.74 | 180 | 1928 | same-strand | 50S ribosome-binding GTPase |
| 14 | PF03764.20 | 0.66 | 159 | 3061.5 | same-strand | Elongation factor G, domain IV |
| 15 | PF14492.8 | 0.66 | 159 | 3061.5 | same-strand | Elongation Factor G, domain III |
| 16 | PF00679.26 | 0.66 | 160 | 3062 | same-strand | Elongation factor G C-terminus |
++ More..