Result : Q9ZDC3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RP409 |
| NCBI Accession ID | AJ235271.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 217725 |
| Right | 217973 |
| Strand | + |
| Nucleotide Sequence | GTGAAACAGATTTTTTTATTATTTACGCTTTTATTCATTACTTCTGCTTGTAGTAAAAAGTTAAAAGAAACCTTGGGTTTATCAACATCAGGACCGAATGAATATCAAGTACAGCGTGTTAAAACATTAGAAGCCCCCCCTCATTATTACTTAATAGATCCTAGAAGTAATAAAACAACTTATAATAATATAAAAGGGAAACATGAATTGAATGAAGGTGAACAAGCTTTAATGCATGATATGCACTAA |
| Sequence | MKQIFLLFTLLFITSACSKKLKETLGLSTSGPNEYQVQRVKTLEAPPHYYLIDPRSNKTTYNNIKGKHELNEGEQALMHDMH |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9823893 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9ZDC3 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 498457 | 498705 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 501480 | 501728 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 3 | 806101 | 806349 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 4 | 558181 | 558429 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 5 | 555337 | 555585 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 6 | 551073 | 551321 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 7 | 557284 | 557532 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 8 | 626394 | 626642 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 9 | 553598 | 553846 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 10 | 890479 | 890727 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 11 | 681906 | 682151 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 12 | 974491 | 974739 | - | NC_007940.1 | Rickettsia bellii RML369-C |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017049.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00116.22 | 0.92 | 11 | 3079 | opposite-strand | Cytochrome C oxidase subunit II, periplasmic domain |
| 2 | PF02790.17 | 0.92 | 11 | 3079 | opposite-strand | Cytochrome C oxidase subunit II, transmembrane domain |
| 3 | PF01551.24 | 1.0 | 12 | 921.5 | same-strand | Peptidase family M23 |
| 4 | PF19425.1 | 1.0 | 12 | 921.5 | same-strand | Csd3 second domain |
| 5 | PF01252.20 | 1.0 | 12 | 26.5 | same-strand | Signal peptidase (SPase) II |
| 6 | PF08245.14 | 0.92 | 11 | 166 | same-strand | Mur ligase middle domain |
| 7 | PF01098.21 | 0.92 | 11 | 1797 | same-strand | Cell cycle protein |
| 8 | PF04101.18 | 0.83 | 10 | 2933.0 | same-strand | Glycosyltransferase family 28 C-terminal domain |
| 9 | PF03033.22 | 0.83 | 10 | 2933.0 | same-strand | Glycosyltransferase family 28 N-terminal domain |
++ More..