Result : Q9ZCR3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | AJ235272.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 220518 |
| Right | 220733 |
| Strand | - |
| Nucleotide Sequence | ATGAATGATTTAAAATTATTAAGAAGTAAGTTGTCTACTGAAACAATAGAAGAGCTTTATAAAAACCTTAATCTTTTAAAAAAAGAGTTATTTAATTTAAGATTTCAACAAGCTTTAGGAGAGTTAAAAAATACTAGTAGGTTTTCGTTAGTCAAGAAGTCTATAGCACGTATTAAAACTGAATTAACAAAAAGATCTAATAGTGAGGAATATTAA |
| Sequence | MNDLKLLRSKLSTETIEELYKNLNLLKKELFNLRFQQALGELKNTSRFSLVKKSIARIKTELTKRSNSEEY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | 9823893 |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q9ZCR3 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 81
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 813492 | 813707 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 823736 | 823951 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 3 | 997559 | 997774 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 4 | 908978 | 909193 | - | NC_009881.1 | Rickettsia akari str. Hartford |
| 5 | 937425 | 937640 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 6 | 929437 | 929652 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 7 | 939266 | 939481 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 8 | 945787 | 946002 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 9 | 507247 | 507462 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
| 10 | 1292421 | 1292636 | - | NZ_LN794217.1 | Rickettsia monacensis |
| 11 | 864154 | 864369 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 12 | 1149089 | 1149301 | - | NC_007940.1 | Rickettsia bellii RML369-C |
| 13 | 2216890 | 2217096 | - | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 14 | 2000723 | 2000896 | - | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 15 | 182435 | 182614 | - | NZ_CP014525.1 | Haematospirillum jordaniae |
| 16 | 1245874 | 1246077 | + | NZ_CP030265.1 | Skermanella pratensis |
| 17 | 2657622 | 2657834 | - | NZ_HG917868.1 | Clostridium bornimense |
| 18 | 3243973 | 3244176 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 19 | 368542 | 368745 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 20 | 1949648 | 1949827 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 21 | 226272 | 226451 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 22 | 1614269 | 1614475 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 23 | 3429698 | 3429901 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 24 | 493436 | 493642 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 25 | 857217 | 857396 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 26 | 847315 | 847521 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 27 | 2034102 | 2034308 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 28 | 1751769 | 1751975 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 29 | 1971003 | 1971209 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 30 | 295463 | 295669 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 31 | 490398 | 490604 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 32 | 2515211 | 2515414 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 33 | 505384 | 505587 | + | NZ_CP030280.1 | Blautia argi |
| 34 | 162369 | 162572 | + | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 35 | 1839314 | 1839520 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 36 | 5613551 | 5613754 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 37 | 1857491 | 1857697 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 38 | 73738 | 73944 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 39 | 504246 | 504452 | - | NZ_LR134293.1 | Streptococcus canis |
| 40 | 74459 | 74665 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 41 | 1760030 | 1760236 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 42 | 2475995 | 2476201 | - | NZ_CP054619.1 | Azospirillum oryzae |
| 43 | 754885 | 755091 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 44 | 1714949 | 1715155 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 45 | 155212 | 155415 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 46 | 1446173 | 1446376 | - | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 47 | 2117966 | 2118166 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 48 | 1804516 | 1804698 | + | NZ_CP021330.1 | Maritalea myrionectae |
| 49 | 3723620 | 3723832 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 50 | 1752290 | 1752490 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 51 | 924581 | 924778 | + | NZ_CP029353.1 | Azospirillum thermophilum |
| 52 | 141770 | 141970 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 53 | 1762369 | 1762572 | + | NZ_CP022745.1 | Sphingobium xenophagum |
| 54 | 1779308 | 1779514 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 55 | 2290089 | 2290307 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 56 | 2898191 | 2898394 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 57 | 1939593 | 1939811 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 58 | 2006920 | 2007138 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 59 | 3124836 | 3125024 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 60 | 2535564 | 2535767 | - | NZ_CP060035.1 | Sphingobium fuliginis |
| 61 | 647955 | 648158 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 62 | 2132353 | 2132556 | - | NZ_AP017655.1 | Sphingobium cloacae |
| 63 | 408335 | 408544 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 64 | 175199 | 175399 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 65 | 275124 | 275312 | + | NC_022549.1 | Acholeplasma brassicae |
| 66 | 652696 | 652884 | + | NZ_CP014176.1 | Clostridium argentinense |
| 67 | 1005022 | 1005216 | + | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 68 | 3440736 | 3440939 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 69 | 2400852 | 2401046 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 70 | 1008634 | 1008828 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 71 | 2234157 | 2234390 | - | NC_015673.1 | Corynebacterium resistens DSM 45100 |
| 72 | 218213 | 218428 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 73 | 3932686 | 3932898 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 74 | 1226777 | 1226983 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 75 | 4556867 | 4557079 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 76 | 851472 | 851675 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 77 | 987158 | 987358 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 78 | 1330544 | 1330744 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 79 | 1306940 | 1307140 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 80 | 1321127 | 1321327 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 81 | 1018855 | 1019058 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017049.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00253.23 | 0.89 | 72 | 1593.5 | same-strand | Ribosomal protein S14p/S29e |
| 2 | PF00673.23 | 0.99 | 80 | 1037.5 | same-strand | ribosomal L5P family C-terminus |
| 3 | PF00281.21 | 0.99 | 80 | 1037.5 | same-strand | Ribosomal protein L5 |
| 4 | PF17136.6 | 1.0 | 81 | 706 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 5 | PF00467.31 | 0.99 | 80 | 706.0 | same-strand | KOW motif |
| 6 | PF00238.21 | 1.0 | 81 | 311 | same-strand | Ribosomal protein L14p/L23e |
| 7 | PF00366.22 | 0.99 | 80 | 18.5 | same-strand | Ribosomal protein S17 |
| 8 | PF00252.20 | 1.0 | 81 | -3 | same-strand | Ribosomal protein L16p/L10e |
| 9 | PF00189.22 | 1.0 | 81 | 427 | same-strand | Ribosomal protein S3, C-terminal domain |
| 10 | PF07650.19 | 1.0 | 81 | 427 | same-strand | KH domain |
| 11 | PF00237.21 | 1.0 | 81 | 1094 | same-strand | Ribosomal protein L22p/L17e |
| 12 | PF00203.23 | 0.99 | 80 | 1479.0 | same-strand | Ribosomal protein S19 |
| 13 | PF03947.20 | 0.96 | 78 | 1825.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 14 | PF00181.25 | 0.96 | 78 | 1825.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
++ More..