Result : Q9ZCK6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RP723 |
| NCBI Accession ID | AJ235273.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 37908 |
| Right | 38192 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGAATCAAATTCAAACTCTGTTAAAGAAGATGTCGAAGGTATCAAAAAAGATATTGAAAGCTTAGTTTCAAGATTACGTAATTTAAAAGGTAAAACTGGAGATATTCTAGATGAACAATTAGGTAATTTATCATCCGTTATGGAACATTATAAGGATAAAGGCATAGAGAAAGGAAAAGCTAATTTAGCTGATTTATGTGAGTCTACACGTAATAACCCATTGCGGAATCTCGCTTATGCTTTTGGTGCAGGCGTATTGCTCGCTATTCTTATGAAATAG |
| Sequence | MKESNSNSVKEDVEGIKKDIESLVSRLRNLKGKTGDILDEQLGNLSSVMEHYKDKGIEKGKANLADLCESTRNNPLRNLAYAFGAGVLLAILMK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9823893 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9ZCK6 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 910173 | 910457 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 908601 | 908879 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 3 | 415138 | 415422 | + | NC_007940.1 | Rickettsia bellii RML369-C |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017049.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01653.20 | 0.67 | 2 | 3684.0 | same-strand | NAD-dependent DNA ligase adenylation domain |
| 2 | PF03120.18 | 0.67 | 2 | 3684.0 | same-strand | NAD-dependent DNA ligase OB-fold domain |
| 3 | PF00533.28 | 0.67 | 2 | 3684.0 | same-strand | BRCA1 C Terminus (BRCT) domain |
| 4 | PF12826.9 | 0.67 | 2 | 3684.0 | same-strand | Helix-hairpin-helix motif |
| 5 | PF03119.18 | 0.67 | 2 | 3684.0 | same-strand | NAD-dependent DNA ligase C4 zinc finger domain |
| 6 | PF01702.20 | 0.67 | 2 | 2458.0 | same-strand | Queuine tRNA-ribosyltransferase |
| 7 | PF02470.22 | 1.0 | 3 | 402 | same-strand | MlaD protein |
| 8 | PF00075.26 | 0.67 | 2 | 1150.0 | same-strand | RNase H |
| 9 | PF06230.13 | 0.67 | 2 | 2895.0 | opposite-strand | LpxI C-terminal domain |
| 10 | PF17930.3 | 0.67 | 2 | 2895.0 | opposite-strand | LpxI N-terminal domain |
++ More..