Result : Q9ZCK4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RP725 |
| NCBI Accession ID | AJ235273.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 39039 |
| Right | 39341 |
| Strand | - |
| Nucleotide Sequence | ATGTCTTGGATAGATAAGTTTTTTATTACTTTTTTTTATACAAAAGTAGGTGAAGATGAATTTTTGAATCAATATTATGAAAGTCGTAATAATATTGATTATTTAGGACGTTCACGGAGGTGTGTTATTTATAAAAATATAAATGAGTCGACAAAAATTCCGCCAAGTTGGTATTCTTGGTTACATCATTTAGTAAATGAGATACCAAAAAATGTTCAACTTTTTCCATGGCAACAAAATAATAAAATAACTAAGAAGCTGCCTAAAACATCAAATCTTAAATATAATAGATGGCAACCATAA |
| Sequence | MSWIDKFFITFFYTKVGEDEFLNQYYESRNNIDYLGRSRRCVIYKNINESTKIPPSWYSWLHHLVNEIPKNVQLFPWQQNNKITKKLPKTSNLKYNRWQP |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01534. Profile Description: NADH ubiquinone oxidoreductase subunit NDUFA12. NADH:ubiquinone oxidoreductase 18 kDa subunit; Provisional |
| Pubmed ID | 9823893 |
| Domain | CDD:412949 |
| Functional Category | Others |
| Uniprot ID | Q9ZCK4 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 911304 | 911606 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 909752 | 910054 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 3 | 1045572 | 1045871 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 4 | 1036418 | 1036717 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 5 | 1038829 | 1039128 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 6 | 363098 | 363397 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 7 | 1047088 | 1047387 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 8 | 1029396 | 1029695 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 9 | 537612 | 537911 | - | NZ_LN794217.1 | Rickettsia monacensis |
| 10 | 412676 | 412975 | + | NC_007940.1 | Rickettsia bellii RML369-C |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017049.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02470.22 | 1.0 | 10 | 25.0 | same-strand | MlaD protein |
| 2 | PF00075.26 | 1.0 | 10 | -12.0 | same-strand | RNase H |
| 3 | PF06230.13 | 1.0 | 10 | 1709.5 | opposite-strand | LpxI C-terminal domain |
| 4 | PF17930.3 | 1.0 | 10 | 1709.5 | opposite-strand | LpxI N-terminal domain |
| 5 | PF01121.22 | 0.9 | 9 | 2514 | opposite-strand | Dephospho-CoA kinase |
| 6 | PF13238.8 | 0.6 | 6 | 2518.0 | opposite-strand | AAA domain |
| 7 | PF00929.26 | 0.9 | 9 | 3080 | opposite-strand | Exonuclease |
++ More..