| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized HTH-type transcriptional regulator RP766 |
| NCBI Accession ID | AJ235273.1 |
| Organism | Rickettsia prowazekii (strain Madrid E) |
| Left | 84832 |
| Right | 85110 |
| Strand | - |
| Nucleotide Sequence | ATGTATATATATAAATCGTTTATTTATTCAGAGGTTATTAATATGGCACTTGCTACTAAAGTAAAAGAATTTTTAGAAGAAAAATTAAAACAAGAAAAGATAGATCGTAAATATCTTGCTCAGGTCACTAATATCCCTTATACTACTGTTAGTAGAATTATGAGAGCAGAAGCTAATCGTGAATTTAATCCTGAAATAGATACTATTTTAAAAATAGCAAAATATTTTAATTGTACTATGGATGAGGTAATAAAAAGAAAAGTGCATAATAATTCATAA |
| Sequence | MYIYKSFIYSEVINMALATKVKEFLEEKLKQEKIDRKYLAQVTNIPYTTVSRIMRAEANREFNPEIDTILKIAKYFNCTMDEVIKRKVHNNS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 9823893 |
| Domain | CDD:419869 |
| Functional Category | DNA-binding |
| Uniprot ID | Q9ZCH6 |
| ORF Length (Amino Acid) | 92 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 957094 | 957372 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 2 | 957712 | 957948 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 3 | 1093879 | 1094115 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 4 | 1092292 | 1092528 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 5 | 1100369 | 1100605 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 6 | 1105082 | 1105318 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 7 | 352032 | 352268 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
| 8 | 1061224 | 1061460 | - | NC_009881.1 | Rickettsia akari str. Hartford |
| 9 | 1166814 | 1167050 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 10 | 94220 | 94456 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 11 | 988638 | 988871 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 12 | 151748 | 151987 | + | NC_007940.1 | Rickettsia bellii RML369-C |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00625.23 | 1.0 | 12 | 137.0 | same-strand | Guanylate kinase |
| 2 | PF04085.16 | 1.0 | 12 | 524.5 | same-strand | rod shape-determining protein MreC |
| 3 | PF06723.15 | 1.0 | 12 | 1366.5 | same-strand | MreB/Mbl protein |
| 4 | PF14450.8 | 1.0 | 12 | 1366.5 | same-strand | Cell division protein FtsA |
| 5 | PF03739.16 | 1.0 | 12 | 2603.5 | same-strand | Lipopolysaccharide export system permease LptF/LptG |
| 6 | PF00691.22 | 1.0 | 12 | 4112.0 | same-strand | OmpA family |