Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein RP812 |
NCBI Accession ID | AJ235273.1 |
Organism | Rickettsia prowazekii (strain Madrid E) |
Left | 148568 |
Right | 148801 |
Strand | + |
Nucleotide Sequence | ATGGCAATATCTGCAGAAGAGTTAGAAAAAATACTTAAAAAATCTTTTCCAAGTAGTGTAATAAAAATTACTGATTTAGTAGGAGATCAAGACCATTATGCTTTAGAAATATCAGATGCTCAATTTAATGGACTTTCTTTAATTAATCAACATAAATTAGTAAAAAATGCCTTATCTGAAATATTAAATAAAAAACTACATTCAATCAGCATAAAAACTATTTCAATACCTTAA |
Sequence | MAISAEELEKILKKSFPSSVIKITDLVGDQDHYALEISDAQFNGLSLINQHKLVKNALSEILNKKLHSISIKTISIP |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00386. Profile Description: BolA-like protein. transcriptional regulator BolA; Provisional |
Pubmed ID | 9823893 |
Domain | CDD:412350 |
Functional Category | Others |
Uniprot ID | Q9ZCE4 |
ORF Length (Amino Acid) | 77 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1020837 | 1021070 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
2 | 1022807 | 1023058 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
3 | 1053529 | 1053780 | + | NC_016929.1 | Rickettsia canadensis str. CA410 |
4 | 231214 | 231453 | - | NZ_LN794217.1 | Rickettsia monacensis |
5 | 283011 | 283250 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
6 | 1160991 | 1161230 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
7 | 1173686 | 1173925 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
8 | 1128870 | 1129109 | + | NC_009881.1 | Rickettsia akari str. Hartford |
9 | 1159435 | 1159674 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
10 | 1167590 | 1167829 | + | NC_016639.1 | Rickettsia slovaca 13-B |
11 | 17827 | 18057 | + | NC_007940.1 | Rickettsia bellii RML369-C |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06347.15 | 1.0 | 11 | 2199 | opposite-strand | Bacterial SH3 domain |
2 | PF08239.13 | 1.0 | 11 | 2199 | opposite-strand | Bacterial SH3 domain |
3 | PF00999.23 | 1.0 | 11 | 479 | opposite-strand | Sodium/hydrogen exchanger family |
4 | PF02254.20 | 1.0 | 11 | 479 | opposite-strand | TrkA-N domain |
5 | PF17836.3 | 0.82 | 9 | 479 | opposite-strand | PglD N-terminal domain |
6 | PF02410.17 | 1.0 | 11 | 156 | opposite-strand | Ribosomal silencing factor during starvation |