Protein name |
Anthracycline acyl carrier protein DpsG |
NCBI Accession ID |
U77891.1 |
Organism |
Streptomyces peucetius |
Left |
3139 |
Right |
3393 |
Strand |
- |
Nucleotide Sequence |
ATGGCTGAGCTCAGCCTGGCGGAACTGCGGGAGATCATGCGGCAGAGCCTGGGGGAGGACGAGGTCCCCGACCTTGCGGACGCGGACACCGTGACCTTCGAGGACCTCGGGCTCGACTCCCTGGCCGTCCTGGAAACGGTCAACCACATCGAGCGGACCTATGGCGTGAAGCTGCCCGAGGAGGAACTGGCGGAGGTCAGGACGCCGCATAGCATGCTGATCTTCGTCAACGAGAGGCTGCGAGCGGCGGCATGA |
Sequence |
MAELSLAELREIMRQSLGEDEVPDLADADTVTFEDLGLDSLAVLETVNHIERTYGVKLPEEELAEVRTPHSMLIFVNERLRAAA |
Source of smORF |
Swiss-Prot |
Function |
Involved in the biosynthesis of aklanonate which is an important precursor common to the formation of the clinically significant anthracyclines such as carminomycin, daunorubicin (daunomycin), rhodomycin, aclacinomycin T (aklavin) and aclacinomycin A (aclarubicin). These compounds are aromatic polyketide antibiotics that exhibit high cytotoxicity and are widely applied in the chemotherapy of a variety of cancers. {ECO:0000269|Pubmed:9864344}. |
Pubmed ID |
9864344
|
Domain |
CDD:415812 |
Functional Category |
Others |
Uniprot ID |
Q9ZAU0
|
ORF Length (Amino Acid) |
84 |