Result : Q9Z8K5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Late transcription unit B protein |
| NCBI Accession ID | AE001363.1 |
| Organism | Chlamydia pneumoniae (Chlamydophila pneumoniae) |
| Left | 378797 |
| Right | 379090 |
| Strand | - |
| Nucleotide Sequence | ATGGGGAAGCCTAAGAAGAGCAGAACGGATAGGGCTTTGGCTCAGGAGATTCAAAAGAAATCAACGGAAGTGTTGAAGAAGCCTGCGCGGATAAAAGCTAAAAATCGTCGTAAATTTCTTATTGCTAAGGAACAGAAAACTCTTAAACACCGTGCTCAAGAATACGATCAGTTAGTTCGCTCTCTCTTAGATTCTCAGAAGAAGGACACCGATAAAGTTTTGATTTTCAATTATGAGAATGGGTTTGTTTTTACTGACAAGGACCATTTTAGTAAGTACTCTATCCGTCTTTAG |
| Sequence | MGKPKKSRTDRALAQEIQKKSTEVLKKPARIKAKNRRKFLIAKEQKTLKHRAQEYDQLVRSLLDSQKKDTDKVLIFNYENGFVFTDKDHFSKYSIRL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17455. Profile Description: Late transcription unit B protein. This is a family of unknown function which is specific to Chlamydia late transcription unit B protein. |
| Pubmed ID | 10192388 10684935 10871362 |
| Domain | CDD:407510 |
| Functional Category | Others |
| Uniprot ID | Q9Z8K5 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 376211 | 376504 | - | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| 2 | 655957 | 656247 | - | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 3 | 508155 | 508445 | + | NC_003361.3 | Chlamydia caviae GPIC |
| 4 | 888466 | 888720 | + | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 5 | 507776 | 508066 | + | NC_017287.1 | Chlamydia psittaci 6BC |
| 6 | 478471 | 478719 | + | NC_022439.1 | Chlamydia pecorum PV3056/3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005043.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00830.21 | 1.0 | 6 | 5530.5 | opposite-strand | Ribosomal L28 family |
| 2 | PF01977.18 | 1.0 | 6 | 3767.5 | opposite-strand | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase |
| 3 | PF13091.8 | 1.0 | 6 | 2606.0 | opposite-strand | PLD-like domain |
| 4 | PF02882.21 | 1.0 | 6 | 721.5 | opposite-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
| 5 | PF00763.25 | 1.0 | 6 | 721.5 | opposite-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
| 6 | PF02424.17 | 1.0 | 6 | 1642.5 | opposite-strand | ApbE family |
| 7 | PF01668.20 | 1.0 | 6 | 2478.0 | same-strand | SmpB protein |
| 8 | PF02767.18 | 1.0 | 6 | 3177.0 | opposite-strand | DNA polymerase III beta subunit, central domain |
| 9 | PF00712.21 | 1.0 | 6 | 3177.0 | opposite-strand | DNA polymerase III beta subunit, N-terminal domain |
| 10 | PF02768.17 | 1.0 | 6 | 3177.0 | opposite-strand | DNA polymerase III beta subunit, C-terminal domain |
++ More..