Result : Q9Z7Z5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small cysteine-rich outer membrane protein OmcA (Small-CRP) (9 kDa cysteine-rich lipoprotein) (9KD-CRP) |
| NCBI Accession ID | X53511.1 |
| Organism | Chlamydia pneumoniae (Chlamydophila pneumoniae) |
| Left | 300 |
| Right | 572 |
| Strand | + |
| Nucleotide Sequence | ATGAAGAAAGCTGTTTTAATTGCTGCAATGTTTTGTGGAGTAGTTAGCTTAAGTAGCTCGTGCCGCATTGTAGATTGTTGTTTTGAGGATCCTTGCGCACCCTCTTCTTGCAATCCTTGTGAAGTAATAAGAAAAAAAGAAAGATCTTGCGGCGGTAATGCTTGTGGGTCCTACGTTCCTTCTTGTTCTAATCCATGTGGTTCAACAGAGTGTAACTCTCAAAGCCCACAAGTTAAAGGTTGTACATCACCTGATGGCAGATGCAAACAGTAA |
| Sequence | MKKAVLIAAMFCGVVSLSSCCRIVDCCFEDPCAPSSCNPCEVIRKKERSCGGNACGSYVPSCSNPCGSTECNSQSPQVKGCTSPDGRCKQ |
| Source of smORF | Swiss-Prot |
| Function | In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity). {ECO:0000250}. |
| Pubmed ID | 7582008 10192388 10684935 10871362 |
| Domain | CDD:308876 |
| Functional Category | Others |
| Uniprot ID | Q9Z7Z5 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 640350 | 640622 | - | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| 2 | 967873 | 968142 | - | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 3 | 197747 | 198013 | + | NC_003361.3 | Chlamydia caviae GPIC |
| 4 | 198742 | 199005 | + | NC_017287.1 | Chlamydia psittaci 6BC |
| 5 | 623607 | 623873 | + | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 6 | 866394 | 866660 | - | NC_002620.2 | Chlamydia muridarum str. Nigg |
| 7 | 561202 | 561468 | - | NZ_LS398098.1 | Chlamydia suis |
| 8 | 513779 | 514045 | - | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
| 9 | 191954 | 192202 | + | NC_022439.1 | Chlamydia pecorum PV3056/3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005043.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03572.20 | 1.0 | 9 | 2566 | opposite-strand | Peptidase family S41 |
| 2 | PF17804.3 | 1.0 | 9 | 2566 | opposite-strand | Tail specific protease N-terminal domain |
| 3 | PF00595.26 | 1.0 | 9 | 2566 | opposite-strand | PDZ domain |
| 4 | PF13180.8 | 1.0 | 9 | 2566 | opposite-strand | PDZ domain |
| 5 | PF17820.3 | 1.0 | 9 | 2566 | opposite-strand | PDZ domain |
| 6 | PF05745.13 | 1.0 | 9 | 2046 | same-strand | Chlamydia 15 kDa cysteine-rich outer membrane protein (CRPA) |
| 7 | PF03504.15 | 1.0 | 9 | 166 | same-strand | Chlamydia cysteine-rich outer membrane protein 6 |
| 8 | PF00749.23 | 1.0 | 9 | 610 | same-strand | tRNA synthetases class I (E and Q), catalytic domain |
| 9 | PF19269.1 | 1.0 | 9 | 610 | same-strand | Anticodon binding domain |
| 10 | PF12728.9 | 1.0 | 9 | 2386 | same-strand | Helix-turn-helix domain |
| 11 | PF05677.14 | 0.67 | 6 | 3615 | same-strand | Chlamydia CHLPS protein (DUF818) |
| 12 | PF02272.21 | 0.78 | 7 | 4990 | same-strand | DHHA1 domain |
| 13 | PF17768.3 | 0.78 | 7 | 4990 | same-strand | RecJ OB domain |
| 14 | PF01368.22 | 0.78 | 7 | 4990 | same-strand | DHH family |
++ More..