Result : Q9Z7J5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein CPn_0710/CP_0036/CPj0710/CpB0737 |
| NCBI Accession ID | AE001363.1 |
| Organism | Chlamydia pneumoniae (Chlamydophila pneumoniae) |
| Left | 796207 |
| Right | 796461 |
| Strand | - |
| Nucleotide Sequence | ATGGCTACAAATAAAAGTTGCACAGCATTCGATTTTAATAAGATGCTAGACGGCGTATGTACTTACGTGAAGGGTGTTCAACAGTATTTAACTGAGTTAGAGACATCAACACAAGGCACTGTCGATTTGGGAACCATGTTTAATTTGCAATTCCGTATGCAGATCTTATCACAGTATATGGAATCGGTGTCCAACATCCTAACCGCTGTGAACACAGAGATGATCACAATGGCTAGAGCAGTTAAAGGAAGTTAA |
| Sequence | MATNKSCTAFDFNKMLDGVCTYVKGVQQYLTELETSTQGTVDLGTMFNLQFRMQILSQYMESVSNILTAVNTEMITMARAVKGS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 10192388 10684935 10871362 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9Z7J5 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 793529 | 793783 | - | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| 2 | 763680 | 763892 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
| 3 | 811825 | 812037 | + | NZ_LS398098.1 | Chlamydia suis |
| 4 | 41762 | 41974 | + | NC_022439.1 | Chlamydia pecorum PV3056/3 |
| 5 | 42603 | 42857 | + | NC_017287.1 | Chlamydia psittaci 6BC |
| 6 | 42601 | 42813 | + | NC_003361.3 | Chlamydia caviae GPIC |
| 7 | 1123208 | 1123420 | - | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 8 | 473914 | 474126 | + | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 9 | 43461 | 43673 | + | NC_002620.2 | Chlamydia muridarum str. Nigg |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005043.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17458.4 | 1.0 | 9 | 3031 | same-strand | Family of unknown function (DUF5421) |
| 2 | PF16789.7 | 1.0 | 9 | 2524 | same-strand | YscO-like protein |
| 3 | PF00006.27 | 1.0 | 9 | 1177 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 4 | PF18269.3 | 1.0 | 9 | 1177 | same-strand | T3SS EscN ATPase C-terminal domain |
| 5 | PF02874.25 | 0.89 | 8 | 1177.5 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 6 | PF17376.4 | 1.0 | 9 | 66 | same-strand | Family of unknown function (DUF5398) |
| 7 | PF16697.7 | 1.0 | 9 | 361 | same-strand | Inner membrane component of T3SS, cytoplasmic domain |
| 8 | PF00498.28 | 1.0 | 9 | 361 | same-strand | FHA domain |
| 9 | PF04972.19 | 0.89 | 8 | 361.5 | same-strand | BON domain |
| 10 | PF05932.15 | 1.0 | 9 | 2853 | same-strand | Tir chaperone protein (CesT) family |
| 11 | PF05201.17 | 1.0 | 9 | 3618 | same-strand | Glutamyl-tRNAGlu reductase, N-terminal domain |
| 12 | PF01751.24 | 1.0 | 9 | 5189 | opposite-strand | Toprim domain |
| 13 | PF02518.28 | 1.0 | 9 | 5189 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 14 | PF00986.23 | 1.0 | 9 | 5189 | opposite-strand | DNA gyrase B subunit, carboxyl terminus |
++ More..