Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein CPn_0710/CP_0036/CPj0710/CpB0737 |
NCBI Accession ID | AE001363.1 |
Organism | Chlamydia pneumoniae (Chlamydophila pneumoniae) |
Left | 796207 |
Right | 796461 |
Strand | - |
Nucleotide Sequence | ATGGCTACAAATAAAAGTTGCACAGCATTCGATTTTAATAAGATGCTAGACGGCGTATGTACTTACGTGAAGGGTGTTCAACAGTATTTAACTGAGTTAGAGACATCAACACAAGGCACTGTCGATTTGGGAACCATGTTTAATTTGCAATTCCGTATGCAGATCTTATCACAGTATATGGAATCGGTGTCCAACATCCTAACCGCTGTGAACACAGAGATGATCACAATGGCTAGAGCAGTTAAAGGAAGTTAA |
Sequence | MATNKSCTAFDFNKMLDGVCTYVKGVQQYLTELETSTQGTVDLGTMFNLQFRMQILSQYMESVSNILTAVNTEMITMARAVKGS |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 10192388 10684935 10871362 |
Domain | |
Functional Category | Others |
Uniprot ID | Q9Z7J5 |
ORF Length (Amino Acid) | 84 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 793529 | 793783 | - | NC_005043.1 | Chlamydia pneumoniae TW-183 |
2 | 763680 | 763892 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
3 | 811825 | 812037 | + | NZ_LS398098.1 | Chlamydia suis |
4 | 41762 | 41974 | + | NC_022439.1 | Chlamydia pecorum PV3056/3 |
5 | 42603 | 42857 | + | NC_017287.1 | Chlamydia psittaci 6BC |
6 | 42601 | 42813 | + | NC_003361.3 | Chlamydia caviae GPIC |
7 | 1123208 | 1123420 | - | NC_007899.1 | Chlamydia felis Fe/C-56 |
8 | 473914 | 474126 | + | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
9 | 43461 | 43673 | + | NC_002620.2 | Chlamydia muridarum str. Nigg |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17458.4 | 1.0 | 9 | 3031 | same-strand | Family of unknown function (DUF5421) |
2 | PF16789.7 | 1.0 | 9 | 2524 | same-strand | YscO-like protein |
3 | PF00006.27 | 1.0 | 9 | 1177 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
4 | PF18269.3 | 1.0 | 9 | 1177 | same-strand | T3SS EscN ATPase C-terminal domain |
5 | PF02874.25 | 0.89 | 8 | 1177.5 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
6 | PF17376.4 | 1.0 | 9 | 66 | same-strand | Family of unknown function (DUF5398) |
7 | PF16697.7 | 1.0 | 9 | 361 | same-strand | Inner membrane component of T3SS, cytoplasmic domain |
8 | PF00498.28 | 1.0 | 9 | 361 | same-strand | FHA domain |
9 | PF04972.19 | 0.89 | 8 | 361.5 | same-strand | BON domain |
10 | PF05932.15 | 1.0 | 9 | 2853 | same-strand | Tir chaperone protein (CesT) family |
11 | PF05201.17 | 1.0 | 9 | 3618 | same-strand | Glutamyl-tRNAGlu reductase, N-terminal domain |
12 | PF01751.24 | 1.0 | 9 | 5189 | opposite-strand | Toprim domain |
13 | PF02518.28 | 1.0 | 9 | 5189 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
14 | PF00986.23 | 1.0 | 9 | 5189 | opposite-strand | DNA gyrase B subunit, carboxyl terminus |