Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S20 |
NCBI Accession ID | AE001363.1 |
Organism | Chlamydia pneumoniae (Chlamydophila pneumoniae) |
Left | 851037 |
Right | 851336 |
Strand | - |
Nucleotide Sequence | ATGGCACCTAAAAAACCGAATAAAAAAAACGTTATACAAAGAAGACCTTCTGCTGAAAAACGCATTCTAACTGCTCAAAAAAGAGAGTTAATCAATCACAGCTTCAAATCTAAAGTGAAAACAATAGTCAAAAAGTTTGAAGCATCTTTAAAACTCGACGACACTCAAGCCACTCTTAGCAACTTACAATCCGTCTACAGTGTTGTAGATAAGGCTGTAAAGCGAGGTATCTTCAAAGATAATAAGGCAGCACGCATTAAATCTAAAGCAACCTTAAAAGTTAACGCGAGAGCATCGTGA |
Sequence | MAPKKPNKKNVIQRRPSAEKRILTAQKRELINHSFKSKVKTIVKKFEASLKLDDTQATLSNLQSVYSVVDKAVKRGIFKDNKAARIKSKATLKVNARAS |
Source of smORF | Swiss-Prot |
Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
Pubmed ID | 10192388 10684935 10871362 |
Domain | CDD:412349 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q9Z7F2 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 848359 | 848658 | - | NC_005043.1 | Chlamydia pneumoniae TW-183 |
2 | 1164009 | 1164305 | + | NC_003361.3 | Chlamydia caviae GPIC |
3 | 9001 | 9297 | - | NC_007899.1 | Chlamydia felis Fe/C-56 |
4 | 1095349 | 1095639 | + | NC_022439.1 | Chlamydia pecorum PV3056/3 |
5 | 1162384 | 1162680 | + | NC_017287.1 | Chlamydia psittaci 6BC |
6 | 745936 | 746232 | + | NZ_LS398098.1 | Chlamydia suis |
7 | 422745 | 423041 | + | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
8 | 697641 | 697937 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
9 | 1050752 | 1051048 | + | NC_002620.2 | Chlamydia muridarum str. Nigg |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00132.26 | 0.67 | 6 | 5237.0 | same-strand | Bacterial transferase hexapeptide (six repeats) |
2 | PF00486.30 | 0.67 | 6 | 4473.0 | same-strand | Transcriptional regulatory protein, C terminal |
3 | PF07079.13 | 0.67 | 6 | 2430.5 | opposite-strand | Protein of unknown function (DUF1347) |
4 | PF13604.8 | 0.67 | 6 | 898.0 | opposite-strand | AAA domain |
5 | PF13245.8 | 0.67 | 6 | 898.0 | opposite-strand | AAA domain |
6 | PF13538.8 | 0.67 | 6 | 898.0 | opposite-strand | UvrD-like helicase C-terminal domain |
7 | PF18095.3 | 1.0 | 9 | 290 | opposite-strand | UPF0242 C-terminal PAS-like domain |
8 | PF06785.13 | 1.0 | 9 | 290 | opposite-strand | Uncharacterised protein family (UPF0242) N-terminus |
9 | PF04539.18 | 1.0 | 9 | 1606 | opposite-strand | Sigma-70 region 3 |
10 | PF04542.16 | 1.0 | 9 | 1606 | opposite-strand | Sigma-70 region 2 |
11 | PF04545.18 | 1.0 | 9 | 1606 | opposite-strand | Sigma-70, region 4 |
12 | PF03979.16 | 1.0 | 9 | 1606 | opposite-strand | Sigma-70 factor, region 1.1 |
13 | PF00140.22 | 1.0 | 9 | 1606 | opposite-strand | Sigma-70 factor, region 1.2 |
14 | PF02152.20 | 0.89 | 8 | 3396.0 | opposite-strand | Dihydroneopterin aldolase |
15 | PF00809.24 | 0.89 | 8 | 3753.5 | opposite-strand | Pterin binding enzyme |
16 | PF01288.22 | 0.89 | 8 | 3753.5 | opposite-strand | 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) |
17 | PF00186.21 | 0.89 | 8 | 5085.5 | opposite-strand | Dihydrofolate reductase |