Result : Q9Z7F2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | AE001363.1 |
| Organism | Chlamydia pneumoniae (Chlamydophila pneumoniae) |
| Left | 851037 |
| Right | 851336 |
| Strand | - |
| Nucleotide Sequence | ATGGCACCTAAAAAACCGAATAAAAAAAACGTTATACAAAGAAGACCTTCTGCTGAAAAACGCATTCTAACTGCTCAAAAAAGAGAGTTAATCAATCACAGCTTCAAATCTAAAGTGAAAACAATAGTCAAAAAGTTTGAAGCATCTTTAAAACTCGACGACACTCAAGCCACTCTTAGCAACTTACAATCCGTCTACAGTGTTGTAGATAAGGCTGTAAAGCGAGGTATCTTCAAAGATAATAAGGCAGCACGCATTAAATCTAAAGCAACCTTAAAAGTTAACGCGAGAGCATCGTGA |
| Sequence | MAPKKPNKKNVIQRRPSAEKRILTAQKRELINHSFKSKVKTIVKKFEASLKLDDTQATLSNLQSVYSVVDKAVKRGIFKDNKAARIKSKATLKVNARAS |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | 10192388 10684935 10871362 |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q9Z7F2 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 848359 | 848658 | - | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| 2 | 1164009 | 1164305 | + | NC_003361.3 | Chlamydia caviae GPIC |
| 3 | 9001 | 9297 | - | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 4 | 1095349 | 1095639 | + | NC_022439.1 | Chlamydia pecorum PV3056/3 |
| 5 | 1162384 | 1162680 | + | NC_017287.1 | Chlamydia psittaci 6BC |
| 6 | 745936 | 746232 | + | NZ_LS398098.1 | Chlamydia suis |
| 7 | 422745 | 423041 | + | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 8 | 697641 | 697937 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
| 9 | 1050752 | 1051048 | + | NC_002620.2 | Chlamydia muridarum str. Nigg |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005043.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00132.26 | 0.67 | 6 | 5237.0 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 2 | PF00486.30 | 0.67 | 6 | 4473.0 | same-strand | Transcriptional regulatory protein, C terminal |
| 3 | PF07079.13 | 0.67 | 6 | 2430.5 | opposite-strand | Protein of unknown function (DUF1347) |
| 4 | PF13604.8 | 0.67 | 6 | 898.0 | opposite-strand | AAA domain |
| 5 | PF13245.8 | 0.67 | 6 | 898.0 | opposite-strand | AAA domain |
| 6 | PF13538.8 | 0.67 | 6 | 898.0 | opposite-strand | UvrD-like helicase C-terminal domain |
| 7 | PF18095.3 | 1.0 | 9 | 290 | opposite-strand | UPF0242 C-terminal PAS-like domain |
| 8 | PF06785.13 | 1.0 | 9 | 290 | opposite-strand | Uncharacterised protein family (UPF0242) N-terminus |
| 9 | PF04539.18 | 1.0 | 9 | 1606 | opposite-strand | Sigma-70 region 3 |
| 10 | PF04542.16 | 1.0 | 9 | 1606 | opposite-strand | Sigma-70 region 2 |
| 11 | PF04545.18 | 1.0 | 9 | 1606 | opposite-strand | Sigma-70, region 4 |
| 12 | PF03979.16 | 1.0 | 9 | 1606 | opposite-strand | Sigma-70 factor, region 1.1 |
| 13 | PF00140.22 | 1.0 | 9 | 1606 | opposite-strand | Sigma-70 factor, region 1.2 |
| 14 | PF02152.20 | 0.89 | 8 | 3396.0 | opposite-strand | Dihydroneopterin aldolase |
| 15 | PF00809.24 | 0.89 | 8 | 3753.5 | opposite-strand | Pterin binding enzyme |
| 16 | PF01288.22 | 0.89 | 8 | 3753.5 | opposite-strand | 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) |
| 17 | PF00186.21 | 0.89 | 8 | 5085.5 | opposite-strand | Dihydrofolate reductase |
++ More..