Result : Q9Z6N3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Late transcription unit A protein |
| NCBI Accession ID | AE001363.1 |
| Organism | Chlamydia pneumoniae (Chlamydophila pneumoniae) |
| Left | 1178997 |
| Right | 1179140 |
| Strand | + |
| Nucleotide Sequence | ATGTTTTTCATTGCAGTACGCTCTCGTGGATTTTTAGATATTCATGGTATTTTAGCCGCTCGTAAGGGTAAGCAAGTAGTGAAATCTACTGCGGGCGCATGGATAGGGTCTCGTGGCGCCGTATTCTACAGCCTGGTTTCGTAA |
| Sequence | MFFIAVRSRGFLDIHGILAARKGKQVVKSTAGAWIGSRGAVFYSLVS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17446. Profile Description: Late transcription unit A protein. This is a domain of unknown function found in Chlamydia. |
| Pubmed ID | 10192388 10684935 10871362 |
| Domain | CDD:407506 |
| Functional Category | Others |
| Uniprot ID | Q9Z6N3 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1174700 | 1174843 | + | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| 2 | 840980 | 841123 | - | NC_017287.1 | Chlamydia psittaci 6BC |
| 3 | 841810 | 841953 | - | NC_003361.3 | Chlamydia caviae GPIC |
| 4 | 800279 | 800416 | - | NC_022439.1 | Chlamydia pecorum PV3056/3 |
| 5 | 784220 | 784360 | - | NC_002620.2 | Chlamydia muridarum str. Nigg |
| 6 | 477082 | 477222 | - | NZ_LS398098.1 | Chlamydia suis |
| 7 | 430353 | 430493 | - | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017287.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00342.21 | 1.0 | 7 | 102 | same-strand | Phosphoglucose isomerase |
| 2 | PF00056.25 | 1.0 | 7 | 352 | same-strand | lactate/malate dehydrogenase, NAD binding domain |
| 3 | PF02866.20 | 1.0 | 7 | 352 | same-strand | lactate/malate dehydrogenase, alpha/beta C-terminal domain |
| 4 | PF01266.26 | 1.0 | 7 | 2174 | opposite-strand | FAD dependent oxidoreductase |
| 5 | PF13520.8 | 1.0 | 7 | 3382 | opposite-strand | Amino acid permease |
| 6 | PF00324.23 | 1.0 | 7 | 3382 | opposite-strand | Amino acid permease |
| 7 | PF01862.18 | 0.71 | 5 | 3910 | opposite-strand | Pyruvoyl-dependent arginine decarboxylase (PvlArgDC) |
++ More..