Result : Q9XA10
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division protein CrgA |
| NCBI Accession ID | AL939118.1 |
| Organism | Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) |
| Left | 12380 |
| Right | 12634 |
| Strand | + |
| Nucleotide Sequence | GTGCCGAAGTCACGTATCCGCAAGAAGGCCGATTACACGCCGCCGCCCTCGAAGCAGGCGACCAGCATCAAGCTGACCAGCCGCGGCTGGGTGGCGCCGGTCATGCTGGCCATGTTCGTCATCGGCCTGGCCTGGATCGTCGTCTTCTACGTCACCGACGGTTCCCTGCCCATCGACTCTCTGGGCAACTGGAACATCGTGGTGGGCTTCGGTTTCATCGCCGCGGGGTTCGGCGTCTCGACGCAGTGGAAGTAG |
| Sequence | MPKSRIRKKADYTPPPSKQATSIKLTSRGWVAPVMLAMFVIGLAWIVVFYVTDGSLPIDSLGNWNIVVGFGFIAAGFGVSTQWK |
| Source of smORF | Swiss-Prot |
| Function | Involved in cell division. Coordinates growth and cell division. May act as an inhibitor of Z-ring formation. {ECO:0000255|HAMAP-Rule:MF_00631, ECO:0000269|Pubmed:14594842, ECO:0000269|Pubmed:16452438}. |
| Pubmed ID | 12000953 14594842 16452438 |
| Domain | CDD:416303 |
| Functional Category | Others |
| Uniprot ID | Q9XA10 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 91
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4051140 | 4051394 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 2 | 3678809 | 3679063 | - | NZ_CP015866.1 | Streptomyces parvulus |
| 3 | 5152472 | 5152726 | - | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 4 | 3821907 | 3822161 | - | NZ_CP029043.1 | Streptomyces nigra |
| 5 | 5133523 | 5133777 | + | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 6 | 223227 | 223481 | + | NZ_CP063373.1 | Streptomyces ferrugineus |
| 7 | 5118676 | 5118930 | + | NC_013929.1 | Streptomyces scabiei 87.22 |
| 8 | 5308456 | 5308710 | - | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 9 | 4427684 | 4427938 | - | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 10 | 4868902 | 4869156 | - | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 11 | 3796820 | 3797074 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 12 | 4578012 | 4578266 | + | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 13 | 4622675 | 4622929 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 14 | 4777615 | 4777869 | - | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 15 | 4495832 | 4496086 | - | NZ_CP071839.1 | Streptomyces cyanogenus |
| 16 | 4322446 | 4322700 | + | NZ_CP026652.1 | Streptomyces dengpaensis |
| 17 | 4031361 | 4031615 | - | NZ_CP023703.1 | Streptomyces galilaeus |
| 18 | 5445199 | 5445453 | - | NZ_CP034463.1 | Streptomyces aquilus |
| 19 | 3876356 | 3876610 | - | NZ_CP023407.1 | Streptomyces fungicidicus |
| 20 | 4716753 | 4717007 | + | NZ_CP045643.1 | Streptomyces fagopyri |
| 21 | 4786512 | 4786766 | + | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 22 | 4436792 | 4437046 | - | NC_021985.1 | Streptomyces collinus Tu 365 |
| 23 | 3617896 | 3618150 | - | NZ_CP022310.1 | Streptomyces calvus |
| 24 | 4236693 | 4236947 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 25 | 5142564 | 5142818 | - | NZ_CP022744.1 | Streptomyces lincolnensis |
| 26 | 4933416 | 4933670 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 27 | 3961746 | 3962000 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 28 | 4983548 | 4983805 | + | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 29 | 47869 | 48123 | - | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 30 | 4314953 | 4315207 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 31 | 3882440 | 3882694 | + | NZ_CP020563.1 | Kitasatospora albolonga |
| 32 | 3446200 | 3446454 | - | NC_020990.1 | Streptomyces albidoflavus |
| 33 | 3736224 | 3736478 | + | NZ_CP031742.1 | Streptomyces koyangensis |
| 34 | 3487000 | 3487254 | + | NZ_CP021080.1 | Streptomyces pluripotens |
| 35 | 4316781 | 4317035 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 36 | 4832895 | 4833152 | - | NZ_CP022685.1 | Streptomyces formicae |
| 37 | 3153075 | 3153329 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 38 | 5016677 | 5016934 | - | NZ_CP023690.1 | Streptomyces spectabilis |
| 39 | 4964978 | 4965232 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 40 | 4102151 | 4102405 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 41 | 4009818 | 4010075 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 42 | 3703453 | 3703707 | + | NZ_CP024957.1 | Streptomyces cavourensis |
| 43 | 3793538 | 3793792 | + | NZ_CP029196.1 | Streptomyces venezuelae |
| 44 | 3622185 | 3622442 | - | NZ_CP029254.1 | Streptomyces spongiicola |
| 45 | 4201281 | 4201535 | + | NZ_CP010407.1 | Streptomyces vietnamensis |
| 46 | 3451358 | 3451615 | - | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 47 | 4998930 | 4999184 | + | NZ_CP017248.1 | Streptomyces fodineus |
| 48 | 3948062 | 3948316 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 49 | 3829834 | 3830088 | + | NZ_CP070242.1 | Streptomyces californicus |
| 50 | 3849412 | 3849666 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 51 | 4344572 | 4344826 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 52 | 3997203 | 3997457 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 53 | 3607206 | 3607463 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 54 | 3906863 | 3907117 | + | NZ_CP023693.1 | Streptomyces cinereoruber |
| 55 | 3969617 | 3969871 | - | NZ_CP020700.1 | Streptomyces tsukubensis |
| 56 | 3745530 | 3745784 | + | NZ_CP023692.1 | Streptomyces vinaceus |
| 57 | 3852705 | 3852959 | + | NZ_CP023701.1 | Streptomyces subrutilus |
| 58 | 3606865 | 3607122 | - | NZ_CP031194.1 | Streptomyces paludis |
| 59 | 4750277 | 4750531 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 60 | 3193629 | 3193886 | + | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 61 | 3328931 | 3329188 | + | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 62 | 3858366 | 3858620 | - | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 63 | 4369808 | 4370065 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 64 | 3419456 | 3419713 | + | NZ_CP065253.1 | Streptomyces clavuligerus |
| 65 | 4490214 | 4490468 | + | NZ_CP059991.1 | Streptomyces gardneri |
| 66 | 4209391 | 4209648 | + | NZ_CP060404.1 | Streptomyces buecherae |
| 67 | 20611 | 20862 | - | NZ_CP030862.1 | Streptomyces globosus |
| 68 | 6623490 | 6623747 | - | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 69 | 5833598 | 5833855 | - | NZ_CP065050.1 | Streptomyces solisilvae |
| 70 | 5055101 | 5055358 | + | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 71 | 4350979 | 4351236 | + | NZ_CP019457.1 | Streptomyces lydicus |
| 72 | 4651404 | 4651661 | - | NZ_CP023688.1 | Streptomyces rimosus |
| 73 | 3565092 | 3565346 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 74 | 3760306 | 3760560 | + | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 75 | 4787714 | 4787968 | + | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 76 | 5036637 | 5036891 | + | NZ_CP070326.1 | Streptomyces noursei |
| 77 | 4537638 | 4537892 | + | NZ_CP027306.1 | Streptomyces atratus |
| 78 | 3257811 | 3258065 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 79 | 8235100 | 8235354 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 80 | 3738299 | 3738553 | + | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 81 | 4429003 | 4429257 | + | NZ_CP023691.1 | Streptomyces platensis |
| 82 | 3759176 | 3759436 | - | NZ_CP048882.1 | Streptomyces bathyalis |
| 83 | 3983880 | 3984134 | + | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 84 | 3829920 | 3830174 | - | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 85 | 4365303 | 4365557 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 86 | 3764808 | 3765056 | + | NZ_CP023698.1 | Streptomyces viridifaciens |
| 87 | 4388644 | 4388898 | - | NC_016109.1 | Kitasatospora setae KM-6054 |
| 88 | 2930653 | 2930913 | + | NZ_CP009922.3 | Streptomyces xiamenensis |
| 89 | 3132529 | 3132789 | + | NZ_CP054938.1 | Streptomyces harbinensis |
| 90 | 3520416 | 3520670 | - | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 91 | 26022 | 26279 | - | NC_015671.1 | Cellulomonas gilvus ATCC 13127 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012382.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17258.4 | 0.93 | 85 | 2118 | same-strand | Family of unknown function (DUF5324) |
| 2 | PF00160.23 | 0.99 | 90 | 1297.0 | opposite-strand | Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD |
| 3 | PF01694.24 | 0.98 | 89 | 282 | opposite-strand | Rhomboid family |
| 4 | PF05949.14 | 1.0 | 91 | 147 | opposite-strand | Bacterial protein of unknown function (DUF881) |
| 5 | PF00117.30 | 1.0 | 91 | 1866 | opposite-strand | Glutamine amidotransferase class-I |
| 6 | PF04203.15 | 1.0 | 91 | 2285.0 | opposite-strand | Sortase domain |
++ More..