| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | AM884177.2 |
| Organism | Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) |
| Left | 324069 |
| Right | 324371 |
| Strand | + |
| Nucleotide Sequence | ATGACAGAGTCATATGTAAACAAAGAAGAAATCATCTCTTTAGCAAAGAATGCTGCATTGGAGTTGGAAGATGCCCACGTGGAAGAGTTCGTAACATCTATGAATGACGTCATTGCTTTAATGCAGGAAGTAATCGCGATAGATATTTCGGATATCATTCTTGAAGCTACAGTGCATCATTTCGTTGGTCCAGAGGATCTTAGAGAAGACATGGTGACTTCGGATTTTACTCAAGAAGAATTTTTATCTAACGTTCCCGTGTCGTTGGGAGGATTAGTCAAAGTCCCTACAGTTATCAAATAG |
| Sequence | MTESYVNKEEIISLAKNAALELEDAHVEEFVTSMNDVIALMQEVIAIDISDIILEATVHHFVGPEDLREDMVTSDFTQEEFLSNVPVSLGGLVKVPTVIK |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 18032721 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | B0BAY8 |
| ORF Length (Amino Acid) | 100 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1794 | 2096 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
| 2 | 324034 | 324336 | + | NC_002620.2 | Chlamydia muridarum str. Nigg |
| 3 | 2393 | 2695 | + | NZ_LS398098.1 | Chlamydia suis |
| 4 | 334432 | 334734 | + | NC_003361.3 | Chlamydia caviae GPIC |
| 5 | 734672 | 734974 | + | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 6 | 337726 | 338028 | + | NC_017287.1 | Chlamydia psittaci 6BC |
| 7 | 826928 | 827233 | - | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 8 | 322600 | 322902 | + | NC_022439.1 | Chlamydia pecorum PV3056/3 |
| 9 | 573 | 878 | + | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04070.14 | 1.0 | 9 | 201 | opposite-strand | Domain of unknown function (DUF378) |
| 2 | PF01425.23 | 0.89 | 8 | 15.5 | same-strand | Amidase |
| 3 | PF02934.17 | 1.0 | 9 | 1492 | same-strand | GatB/GatE catalytic domain |
| 4 | PF02637.20 | 1.0 | 9 | 1492 | same-strand | GatB domain |
| 5 | PF17459.4 | 0.89 | 8 | 4431.0 | opposite-strand | Family of unknown function (DUF5422) |
| 6 | PF07548.13 | 0.78 | 7 | 4890 | opposite-strand | Chlamydia polymorphic membrane protein middle domain |