| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000481.1 |
| Organism | Acidothermus cellulolyticus (strain ATCC 43068 / 11B) |
| Left | 2121721 |
| Right | 2122011 |
| Strand | + |
| Nucleotide Sequence | GTGACCGAGCCGCCGCTCCCCCACGAATCAGCCGATGACGGCCGGGCTCGCCTCTCGTACGAGGACGCCCGCGATGAGCTCATCCAGATCGTGCAGCGGTTGGAGCTGGGCGGCCTACCGTTGGAGGAAGCGCTGCGGCTCTGGGAGCGCGGCGAAGAACTGGCCCGCGTCTGCCAGGCGTGGCTGGACGGGGCCCGCGCCCGGCTCGAGGCGTACCGTGCACCGGAGCAGAGCGCGGCGAACGACGTCTCCGCACCAGGATCCGCCGAGGAGCACGACCATGGCCGATAA |
| Sequence | MTEPPLPHESADDGRARLSYEDARDELIQIVQRLELGGLPLEEALRLWERGEELARVCQAWLDGARARLEAYRAPEQSAANDVSAPGSAEEHDHGR |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 19270083 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | A0LW38 |
| ORF Length (Amino Acid) | 96 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2121721 | 2122011 | + | NC_008578.1 | Acidothermus cellulolyticus 11B |
| 2 | 4803224 | 4803496 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 3 | 2726558 | 2726854 | + | NZ_CP026952.1 | Aeromicrobium chenweiae |
| 4 | 2581282 | 2581518 | + | NZ_CP049933.1 | Leucobacter coleopterorum |
| 5 | 3893683 | 3893922 | + | NZ_CP029642.1 | Arthrobacter dokdonellae |
| 6 | 1967891 | 1968148 | - | NZ_CP035491.1 | Agromyces protaetiae |
| 7 | 1644359 | 1644616 | - | NZ_CP013979.1 | Agromyces aureus |
| 8 | 2213333 | 2213581 | + | NZ_CP064760.1 | Microbacterium schleiferi |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13742.8 | 1.0 | 8 | 11.0 | same-strand | OB-fold nucleic acid binding domain |
| 2 | PF10415.11 | 0.62 | 5 | 1521 | same-strand | Fumarase C C-terminus |
| 3 | PF14030.8 | 0.75 | 6 | 0.0 | same-strand | Protein of unknown function (DUF4245) |
| 4 | PF02401.20 | 0.75 | 6 | 1760.0 | opposite-strand | LytB protein |