Result : Q9X7L3

Protein Information

• Protein name: Uncharacterized protein R02378
• NCBI Accession ID: AJ132004.1
• Organism: Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
• Left: 3041
• Right: 3292
• Strand: +
• Nucleotide Sequence: ATGGCTCTCTACATCAAAGATCCCACCGTGGACCGAATGGCGGAAAAACTTCAAGAACGCCTAGGTGTCCGCACCAAGACAGATGCTGTCCGCATTGCTCTGCAACACGAACTGGATCGTGTGGAAGACGAAATTCCGCTGCGCGAAAAGCTGGCCGCCTTGCGGCAACAGGCGCGCGACCGGCTAGGCCCGCCTGTTCACGGGATCGATATGAAAAAGCTTATGGATGAGCTTTGGGAGGAGGGCGAGTGA
• Sequence: MALYIKDPTVDRMAEKLQERLGVRTKTDAVRIALQHELDRVEDEIPLREKLAALRQQARDRLGPPVHGIDMKKLMDELWEEGE
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl01834. Profile Description: Rv0623-like transcription factor. This entry represents the Rv0623-like family of transcription factors associated with the PSK operon.
• Pubmed ID: 11481430 11474104
• Domain: CDD:413087
• Functional Category: Others
• Uniprot ID: Q9X7L3
• ORF Length (Amino Acid): 83

Conservation Analysis

No. of Species: 4

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2564157	2564408	-	NC_020528.1	Sinorhizobium meliloti 2011
2	1456008	1456259	-	NZ_CP022603.1	[Ochrobactrum] quorumnocens
3	2267870	2268115	+	NZ_AP014946.1	Variibacter gotjawalensis
4	449736	449978	+	NZ_CP071454.1	Rhizobium lentis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_020528.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01850.23	1.0	4	-3.0	same-strand	PIN domain