ProsmORF-pred
Result : Q9X2V7
Protein Information
Information Type Description
Protein name Microcin J25 (MccJ25) (Class II lasso peptide) (Ribosomally synthesized and post-translationally modified peptide) (RiPP)
NCBI Accession ID AF061787.1
Organism Escherichia coli
Left 62
Right 238
Strand -
Nucleotide Sequence ATGATTAAGCATTTTCATTTTAATAAACTGTCTTCTGGTAAAAAAAATAATGTTCCATCTCCTGCAAAGGGGGTTATACAAATAAAAAAATCAGCATCGCAACTCACAAAAGGTGGTGCAGGACATGTGCCTGAGTATTTTGTGGGGATTGGTACACCTATATCTTTCTATGGCTGA
Sequence MIKHFHFNKLSSGKKNNVPSPAKGVIQIKKSASQLTKGGAGHVPEYFVGIGTPISFYG
Source of smORF Swiss-Prot
Function Peptide antibiotic that functions through inhibition of the bacterial DNA-dependent RNA polymerase (RNAP) (Pubmed:11443089, Pubmed:12401787). Inhibits transcription by binding deep within RNAP secondary channel, where it sterically blocks the folding of the trigger loop, which is essential for efficient catalysis (Pubmed:15200952, Pubmed:30626643). In addition, it also seems to restrict access of nucleotide substrates to the catalytic center, and shows a partially competitive mode of inhibition with them (Pubmed:15200952, Pubmed:30626643). Exhibits potent bacteriocidal activity against a range of Enterobacteriaceae, including several pathogenic E.coli, Salmonella and Shigella strains (Pubmed:1429464). Also acts on the cytoplasmic membrane of Salmonella newport, producing alteration of membrane permeability and disruption of the subsequent gradient dissipation, which inhibits several processes essential for cell viability, such as oxygen consumption (Pubmed:11731133). Induces bacterial filamentation in susceptible cells in a non-SOS-dependent way, but this phenotype may result from impaired transcription of genes coding for cell division proteins (Pubmed:1429464). {ECO:0000269|Pubmed:11443089, ECO:0000269|Pubmed:11731133, ECO:0000269|Pubmed:12401787, ECO:0000269|Pubmed:1429464, ECO:0000269|Pubmed:15200952, ECO:0000269|Pubmed:30626643}.
Pubmed ID 10198038 10092860 1429464 11731133 11443089 12401787 15200952 18632663 14531661 14531690 14531691 30626643
Domain CDD:380306
Functional Category Antimicrobial
Uniprot ID Q9X2V7
ORF Length (Amino Acid) 58
++ More..