Result : Q9X2B6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | CRISPR-associated endoribonuclease Cas2 (EC 3.1.-.-) |
| NCBI Accession ID | AE000512.1 |
| Organism | Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) |
| Left | 1772691 |
| Right | 1772954 |
| Strand | - |
| Nucleotide Sequence | ATGTACGTCATAATGGTTTACGACGTGAACGAAAAAAGAGTAGCAAAAATTTTGAAAATAGCCAGAAAATACCTCAAATGGGTTCAAAACTCCGTTCTGGAGGGGGAACTTTCCCCCGGAAAATATGAAAAGCTGAAATTGGAGGTTTCAAGACTGATAGACGAGAAAGAAGACTCAGTTAGATTTTACGTTATGGACTCTCAAAAGGTGTTCAACCTGGAAACTCTGGGAGTGGAGAAAGGAGAAGATGGCTTCATCTTCTGA |
| Sequence | MYVIMVYDVNEKRVAKILKIARKYLKWVQNSVLEGELSPGKYEKLKLEVSRLIDEKEDSVRFYVMDSQKVFNLETLGVEKGEDGFIF |
| Source of smORF | Swiss-Prot |
| Function | CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Involved in the integration of spacer DNA into the CRISPR cassette (By similarity). Functions as a ssRNA-specific endoribonuclease. {ECO:0000250, ECO:0000269|Pubmed:18482976}. |
| Pubmed ID | 10360571 18482976 |
| Domain | CDD:416272 |
| Functional Category | Metal-binding |
| Uniprot ID | Q9X2B6 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 78
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1042297 | 1042560 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 2 | 214358 | 214621 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 3 | 208752 | 209015 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 4 | 177820 | 178083 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 5 | 121711 | 121974 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 6 | 2891988 | 2892251 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 7 | 55081 | 55341 | + | NZ_CP016313.1 | Thermus brockianus |
| 8 | 694063 | 694326 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 9 | 2073844 | 2074098 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 10 | 250090 | 250353 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 11 | 2207069 | 2207332 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 12 | 25833 | 26102 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 13 | 2326516 | 2326779 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 14 | 278579 | 278842 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 15 | 2083114 | 2083377 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 16 | 2332558 | 2332821 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 17 | 1930463 | 1930726 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 18 | 351830 | 352093 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 19 | 268066 | 268329 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 20 | 140887 | 141150 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 21 | 2668934 | 2669197 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 22 | 157149 | 157412 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 23 | 2386381 | 2386644 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 24 | 2555595 | 2555858 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 25 | 2638028 | 2638291 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 26 | 2274302 | 2274565 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 27 | 2037822 | 2038085 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 28 | 683605 | 683868 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 29 | 73019 | 73282 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 30 | 589367 | 589630 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 31 | 1194052 | 1194315 | + | NC_021592.1 | Ferroplasma acidarmanus fer1 |
| 32 | 1322672 | 1322941 | + | NZ_LS974202.1 | Mesotoga infera |
| 33 | 1150883 | 1151146 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 34 | 1708655 | 1708915 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 35 | 3061241 | 3061504 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 36 | 881450 | 881674 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 37 | 2869612 | 2869875 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 38 | 2465608 | 2465871 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 39 | 4754783 | 4755046 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 40 | 2618326 | 2618589 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 41 | 2555897 | 2556160 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 42 | 2468573 | 2468836 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 43 | 144890 | 145105 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 44 | 100890 | 101153 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 45 | 2849477 | 2849740 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 46 | 1258720 | 1258983 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 47 | 325985 | 326248 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 48 | 324712 | 324939 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 49 | 832574 | 832786 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 50 | 286503 | 286766 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 51 | 2724874 | 2725137 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 52 | 2657833 | 2658096 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 53 | 1051402 | 1051665 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 54 | 1536640 | 1536915 | - | NZ_AP019551.1 | Athalassotoga saccharophila |
| 55 | 3497679 | 3497942 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 56 | 3285169 | 3285432 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 57 | 1609496 | 1609711 | - | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 58 | 3497863 | 3498126 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 59 | 1596420 | 1596683 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 60 | 4452618 | 4452881 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 61 | 1099428 | 1099691 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 62 | 580569 | 580832 | + | NC_013526.1 | Thermobaculum terrenum ATCC BAA-798 |
| 63 | 1461364 | 1461627 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 64 | 2677578 | 2677841 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 65 | 2795380 | 2795643 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 66 | 620515 | 620778 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 67 | 498775 | 499035 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
| 68 | 4166165 | 4166428 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 69 | 184573 | 184836 | + | NZ_CP036259.1 | Sporomusa termitida |
| 70 | 1124939 | 1125205 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 71 | 343642 | 343866 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 72 | 2524810 | 2525034 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 73 | 75394 | 75657 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 74 | 1145866 | 1146129 | + | NZ_CP009687.1 | Clostridium aceticum |
| 75 | 2764772 | 2765035 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 76 | 861104 | 861316 | - | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 77 | 2779065 | 2779328 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 78 | 263398 | 263667 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 79 | 360707 | 360967 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 80 | 1343774 | 1344037 | + | NC_013156.1 | Methanocaldococcus fervens AG86 |
| 81 | 1219276 | 1219533 | - | NZ_CP008887.1 | Thermococcus eurythermalis |
| 82 | 397538 | 397795 | - | NC_014804.1 | Thermococcus barophilus MP |
| 83 | 1825008 | 1825223 | - | NZ_LT900021.1 | Thermococcus henrietii |
| 84 | 431954 | 432217 | - | NZ_CP009149.1 | Methanocaldococcus bathoardescens |
| 85 | 1575671 | 1575886 | - | NZ_CP015103.1 | Thermococcus siculi |
| 86 | 351301 | 351564 | - | NC_000909.1 | Methanocaldococcus jannaschii DSM 2661 |
| 87 | 844230 | 844487 | - | NZ_CP015520.1 | Thermococcus piezophilus |
| 88 | 2820344 | 2820604 | - | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011297.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00271.33 | 0.72 | 56 | 1608.5 | same-strand | Helicase conserved C-terminal domain |
| 2 | PF00270.31 | 0.77 | 60 | 1617 | same-strand | DEAD/DEAH box helicase |
| 3 | PF01930.19 | 0.81 | 63 | 1018.5 | same-strand | Domain of unknown function DUF83 |
| 4 | PF01867.18 | 0.88 | 69 | 15.5 | same-strand | CRISPR associated protein Cas1 |
| 5 | PF04851.17 | 0.65 | 51 | 1606 | same-strand | Type III restriction enzyme, res subunit |
++ More..