Result : Q9X1Q3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0109 protein TM_1567 |
| NCBI Accession ID | AE000512.1 |
| Organism | Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) |
| Left | 1556555 |
| Right | 1556782 |
| Strand | + |
| Nucleotide Sequence | ATGAAGGAGCTCCTCGAGAAGATTCTTCGGGGAATAGTGAAGCATCCCGAAGAGGTTGTGGTCATGGAGTTCGACGAAGAAGGAAAGAAAGTATACGAAATCGTTGTGAACGAAGAAGATGTTGGACAGGTCATAGGAAAAGATGGAAGAACGATAAAATCTTTGAAGATACTTCTGAGTGCACTCATGGGAGATTCTAAGGAGATCACCATCAAGGTGGTCCGGTGA |
| Sequence | MKELLEKILRGIVKHPEEVVVMEFDEEGKKVYEIVVNEEDVGQVIGKDGRTIKSLKILLSALMGDSKEITIKVVR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00098. Profile Description: K homology (KH) RNA-binding domain, type I. Rrp40, also called exosome component 3 (EXOSC3), or ribosomal RNA-processing protein 40, is a non-catalytic component of the RNA exosome complex which has 3'-->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. Mutations of EXOSC3 gene are associated with neurological diseases. Members in this subfamily contain a divergent KH domain that lacks the RNA-binding GXXG motif. |
| Pubmed ID | 10360571 |
| Domain | CDD:412160 |
| Functional Category | RNA-binding |
| Uniprot ID | Q9X1Q3 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1268016 | 1268243 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 2 | 1244651 | 1244878 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 3 | 1258469 | 1258696 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 4 | 1117461 | 1117688 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 5 | 1088863 | 1089087 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 6 | 770630 | 770854 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 7 | 130489 | 130713 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 8 | 121727 | 121951 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 9 | 1788585 | 1788809 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 10 | 314347 | 314571 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 11 | 2034329 | 2034553 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 12 | 63144 | 63368 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 13 | 980390 | 980614 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 14 | 981545 | 981769 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 15 | 712032 | 712256 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 16 | 1563060 | 1563293 | + | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 17 | 858929 | 859162 | - | NZ_CP011232.1 | Kosmotoga pacifica |
| 18 | 322263 | 322496 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 19 | 920310 | 920540 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 20 | 1884531 | 1884764 | - | NZ_LS974202.1 | Mesotoga infera |
| 21 | 345742 | 345972 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 22 | 423885 | 424115 | - | NZ_LN824141.1 | Defluviitoga tunisiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013642.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10502.11 | 0.86 | 19 | 2194 | same-strand | Signal peptidase, peptidase S26 |
| 2 | PF01245.22 | 1.0 | 22 | 1847.5 | same-strand | Ribosomal protein L19 |
| 3 | PF09936.11 | 1.0 | 22 | 1266.0 | same-strand | SAM-dependent RNA methyltransferase |
| 4 | PF01746.23 | 1.0 | 22 | 535.0 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 5 | PF01782.20 | 1.0 | 22 | -3.0 | same-strand | RimM N-terminal domain |
| 6 | PF05239.18 | 0.77 | 17 | -3 | same-strand | PRC-barrel domain |
| 7 | PF00886.21 | 1.0 | 22 | -3.0 | same-strand | Ribosomal protein S16 |
| 8 | PF00448.24 | 1.0 | 22 | 306.0 | same-strand | SRP54-type protein, GTPase domain |
| 9 | PF02978.21 | 1.0 | 22 | 306.0 | same-strand | Signal peptide binding domain |
| 10 | PF02881.21 | 1.0 | 22 | 306.0 | same-strand | SRP54-type protein, helical bundle domain |
| 11 | PF13401.8 | 1.0 | 22 | 306.0 | same-strand | AAA domain |
++ More..