ProsmORF-pred
Result : Q9X1Q0
Protein Information
Information Type Description
Protein name Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase)
NCBI Accession ID AE000512.1
Organism Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Left 1554532
Right 1554804
Strand +
Nucleotide Sequence ATGAAGGCTCTGAAAATAAGAGTTGAGGGGATCGTTCAAGGAGTGGGCTTTCGATATTTCACAAGAAGAGTTGCGAAATCTCTTGGTGTGAAGGGTTACGTGATGAACATGGATGATGGGTCTGTTTTCATACACGCCGAAGGTGATGAAAATGCCCTTCGGCGTTTTTTGAATGAGGTAGCGAAAGGCCCACCTGCGGCGGTTGTGACGAACGTGAGTGTGGAAGAAACTACGCCTGAAGGATACGAGGACTTCACGATCAAGTATTATTAA
Sequence MKALKIRVEGIVQGVGFRYFTRRVAKSLGVKGYVMNMDDGSVFIHAEGDENALRRFLNEVAKGPPAAVVTNVSVEETTPEGYEDFTIKYY
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional
Pubmed ID 10360571
Domain CDD:412440
Functional Category Others
Uniprot ID Q9X1Q0
ORF Length (Amino Acid) 90
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 39
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1246629 1246901 - NC_009486.1 Thermotoga petrophila RKU-1
2 1260447 1260719 - NC_023151.1 Thermotoga maritima MSB8
3 1269994 1270266 - NC_013642.1 Thermotoga naphthophila RKU-10
4 1115438 1115710 + NC_011978.1 Thermotoga neapolitana DSM 4359
5 824822 825091 - NC_015707.1 Pseudothermotoga thermarum DSM 5069
6 760336 760605 + NZ_AP014509.1 Thermotoga caldifontis AZM44c09
7 385706 385975 - NZ_AP014510.1 Thermotoga profunda AZM34c06
8 1778348 1778617 - NC_022795.1 Pseudothermotoga hypogea DSM 11164 = NBRC 106472
9 777220 777489 + NZ_CP006577.1 Archaeoglobus fulgidus DSM 8774
10 633602 633874 + NC_015320.1 Archaeoglobus veneficus SNP6
11 1180739 1181011 - NC_021169.1 Archaeoglobus sulfaticallidus PM70-1
12 2184149 2184418 + NZ_AP017470.1 Thermotomaculum hydrothermale
13 1119675 1119938 + NC_017461.1 Fervidicoccus fontis Kam940
14 829189 829461 + NZ_CP011267.1 Geoglobus ahangari
15 846237 846482 - NZ_LT603683.1 Bacillus glycinifermentans
16 2530738 2530992 - NZ_CP066076.1 Paraburkholderia ginsengisoli
17 3333798 3334052 - NC_007952.1 Paraburkholderia xenovorans LB400
18 1115453 1115707 - NZ_CP024942.1 Paraburkholderia terricola
19 2255372 2255650 - NC_016599.1 Owenweeksia hongkongensis DSM 17368
20 636609 636848 + NC_016751.1 Marinitoga piezophila KA3
21 3423712 3423966 + NC_010676.1 Paraburkholderia phytofirmans PsJN
22 1184958 1185194 + NZ_CP017562.1 Paraburkholderia sprentiae WSM5005
23 1956113 1956367 - NZ_CP022990.1 Paraburkholderia aromaticivorans
24 2633115 2633369 - NZ_CP024935.1 Paraburkholderia graminis
25 423592 423816 - NZ_AP019551.1 Athalassotoga saccharophila
26 818363 818638 - NZ_CP013984.1 Bacillus inaquosorum
27 776432 776680 + NZ_CP045483.1 Stygiolobus azoricus
28 3335072 3335326 + NZ_CP031466.1 Paraburkholderia caffeinilytica
29 641154 641435 + NZ_CP030848.1 Sphingobacterium hotanense
30 2281611 2281883 + NZ_CP027783.1 Tetragenococcus osmophilus
31 864667 864942 - NC_020207.1 Enterococcus faecium ATCC 8459 = NRRL B-2354
32 941320 941595 - NZ_CP065211.1 Enterococcus lactis
33 2053004 2053240 + NC_009954.1 Caldivirga maquilingensis IC-167
34 1443416 1443694 + NZ_CP013988.1 Aerococcus urinaeequi
35 753083 753361 - NZ_CP014164.1 Aerococcus viridans
36 900387 900608 - NZ_CP017267.1 Vagococcus teuberi
37 77579 77830 + NZ_CP027563.1 Weissella confusa
38 1214393 1214665 + NZ_CP024610.1 Lactobacillus terrae
39 2522400 2522681 - NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
++ More..