Result : Q9X1D7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein TM_1420 |
| NCBI Accession ID | |
| Organism | Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MIVRVCMGSSCHLKGSYEVVRRFQELQKKYNFKLYGSLCFGNCSQGVCVEIDGRLFSRVTPENAEEILKKVLQNG |
| Source of smORF | Swiss-Prot |
| Function | Might be part of a multi-protein complex, possibly involved in metal cluster assembly. |
| Pubmed ID | 10360571 12605255 |
| Domain | CDD:412351 |
| Functional Category | Metal-binding |
| Uniprot ID | Q9X1D7 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1379478 | 1379705 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 2 | 1388040 | 1388267 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 3 | 1364779 | 1365006 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 4 | 1044590 | 1044817 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 5 | 523011 | 523235 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 6 | 991632 | 991856 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 7 | 986341 | 986565 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 8 | 567294 | 567536 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 9 | 477694 | 477921 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 10 | 794577 | 794804 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 11 | 98017 | 98253 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 12 | 266878 | 267105 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 13 | 2802646 | 2802876 | - | NZ_CP016379.1 | Anoxybacter fermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_023151.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02906.16 | 1.0 | 13 | 6 | same-strand | Iron only hydrogenase large subunit, C-terminal domain |
| 2 | PF10588.11 | 0.85 | 11 | 5093 | same-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
| 3 | PF13510.8 | 0.77 | 10 | 5094.0 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 4 | PF00037.29 | 1.0 | 13 | 3175 | same-strand | 4Fe-4S binding domain |
| 5 | PF02256.19 | 0.69 | 9 | 5095 | same-strand | Iron hydrogenase small subunit |
| 6 | PF12838.9 | 1.0 | 13 | 3197 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF14697.8 | 1.0 | 13 | 3175.0 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF12837.9 | 1.0 | 13 | 3210.5 | same-strand | 4Fe-4S binding domain |
| 9 | PF13187.8 | 1.0 | 13 | 3195.5 | same-strand | 4Fe-4S dicluster domain |
| 10 | PF01512.19 | 0.92 | 12 | 3198.5 | same-strand | Respiratory-chain NADH dehydrogenase 51 Kd subunit |
| 11 | PF10589.11 | 0.92 | 12 | 3198.5 | same-strand | NADH-ubiquinone oxidoreductase-F iron-sulfur binding region |
| 12 | PF12797.9 | 0.77 | 10 | 3175.0 | same-strand | 4Fe-4S binding domain |
| 13 | PF13237.8 | 1.0 | 13 | 1576.5 | same-strand | 4Fe-4S dicluster domain |
| 14 | PF10531.11 | 0.92 | 12 | 3198.5 | same-strand | SLBB domain |
| 15 | PF01257.21 | 0.92 | 12 | 2732.5 | same-strand | Thioredoxin-like [2Fe-2S] ferredoxin |
| 16 | PF07228.14 | 0.92 | 12 | 1581.0 | same-strand | Stage II sporulation protein E (SpoIIE) |
| 17 | PF04060.15 | 1.0 | 13 | -7 | same-strand | Putative Fe-S cluster |
++ More..