Protein Information |
Information Type | Description |
---|---|
Protein name | Protein TM_1420 |
NCBI Accession ID | |
Organism | Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MIVRVCMGSSCHLKGSYEVVRRFQELQKKYNFKLYGSLCFGNCSQGVCVEIDGRLFSRVTPENAEEILKKVLQNG |
Source of smORF | Swiss-Prot |
Function | Might be part of a multi-protein complex, possibly involved in metal cluster assembly. |
Pubmed ID | 10360571 12605255 |
Domain | CDD:412351 |
Functional Category | Metal-binding |
Uniprot ID | Q9X1D7 |
ORF Length (Amino Acid) | 75 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1379478 | 1379705 | - | NC_023151.1 | Thermotoga maritima MSB8 |
2 | 1388040 | 1388267 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
3 | 1364779 | 1365006 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
4 | 1044590 | 1044817 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
5 | 523011 | 523235 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
6 | 991632 | 991856 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
7 | 986341 | 986565 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
8 | 567294 | 567536 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
9 | 477694 | 477921 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
10 | 794577 | 794804 | + | NC_011653.1 | Thermosipho africanus TCF52B |
11 | 98017 | 98253 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
12 | 266878 | 267105 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
13 | 2802646 | 2802876 | - | NZ_CP016379.1 | Anoxybacter fermentans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02906.16 | 1.0 | 13 | 6 | same-strand | Iron only hydrogenase large subunit, C-terminal domain |
2 | PF10588.11 | 0.85 | 11 | 5093 | same-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
3 | PF13510.8 | 0.77 | 10 | 5094.0 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
4 | PF00037.29 | 1.0 | 13 | 3175 | same-strand | 4Fe-4S binding domain |
5 | PF02256.19 | 0.69 | 9 | 5095 | same-strand | Iron hydrogenase small subunit |
6 | PF12838.9 | 1.0 | 13 | 3197 | same-strand | 4Fe-4S dicluster domain |
7 | PF14697.8 | 1.0 | 13 | 3175.0 | same-strand | 4Fe-4S dicluster domain |
8 | PF12837.9 | 1.0 | 13 | 3210.5 | same-strand | 4Fe-4S binding domain |
9 | PF13187.8 | 1.0 | 13 | 3195.5 | same-strand | 4Fe-4S dicluster domain |
10 | PF01512.19 | 0.92 | 12 | 3198.5 | same-strand | Respiratory-chain NADH dehydrogenase 51 Kd subunit |
11 | PF10589.11 | 0.92 | 12 | 3198.5 | same-strand | NADH-ubiquinone oxidoreductase-F iron-sulfur binding region |
12 | PF12797.9 | 0.77 | 10 | 3175.0 | same-strand | 4Fe-4S binding domain |
13 | PF13237.8 | 1.0 | 13 | 1576.5 | same-strand | 4Fe-4S dicluster domain |
14 | PF10531.11 | 0.92 | 12 | 3198.5 | same-strand | SLBB domain |
15 | PF01257.21 | 0.92 | 12 | 2732.5 | same-strand | Thioredoxin-like [2Fe-2S] ferredoxin |
16 | PF07228.14 | 0.92 | 12 | 1581.0 | same-strand | Stage II sporulation protein E (SpoIIE) |
17 | PF04060.15 | 1.0 | 13 | -7 | same-strand | Putative Fe-S cluster |