| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Flagellar hook-basal body complex protein FliE |
| NCBI Accession ID | AE000512.1 |
| Organism | Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) |
| Left | 1384945 |
| Right | 1385229 |
| Strand | + |
| Nucleotide Sequence | ATGGTTGACAGGATAGAGGGACTCGGCCCTTTGAGCCAGAGTGGAAAGACTCAAAAGAAAAGTGAAAACAACTTTTCAGAAGCGCTGAAAGAAGCACTGGAAAAGGTAAACGACATACAGAAGAAAGCCGAGAAGGCAGCGGATGATTTCGCCCAGGGCAGGATAAGCAACATACACGAGGTTATAATAGAAGCCGAGAAGGCTTCCATAGCGTTGAGGCTCACCGTCGAAGTAAGAAACAGAATCGTGGAAGCTTACAGAGACATCATGAGGATGCAAATCTGA |
| Sequence | MVDRIEGLGPLSQSGKTQKKSENNFSEALKEALEKVNDIQKKAEKAADDFAQGRISNIHEVIIEAEKASIALRLTVEVRNRIVEAYRDIMRMQI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09139. Profile Description: Flagellar hook-basal body complex protein FliE. fliE is a component of the flagellar hook-basal body complex located possibly at (MS-ring)-rod junction. [Cellular processes, Chemotaxis and motility] |
| Pubmed ID | 10360571 |
| Domain | CDD:415593 |
| Functional Category | Others |
| Uniprot ID | Q9X186 |
| ORF Length (Amino Acid) | 94 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1430021 | 1430305 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 2 | 1431292 | 1431576 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 3 | 1407040 | 1407324 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 4 | 1186638 | 1186922 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 5 | 1504080 | 1504373 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 6 | 83046 | 83339 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 7 | 83920 | 84213 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 8 | 883434 | 883724 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 9 | 2044441 | 2044740 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 10 | 763161 | 763448 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 11 | 1558976 | 1559269 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 12 | 1445252 | 1445539 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 13 | 2002006 | 2002299 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 14 | 1151524 | 1151811 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 15 | 1870102 | 1870392 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 16 | 1366818 | 1367117 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 17 | 1844046 | 1844345 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 18 | 1671514 | 1671822 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 19 | 1767169 | 1767438 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 20 | 2448704 | 2448991 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 21 | 876661 | 876948 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00460.22 | 1.0 | 21 | 15.5 | same-strand | Flagella basal body rod protein |