Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0150 protein TM_1313 |
NCBI Accession ID | AE000512.1 |
Organism | Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) |
Left | 1332995 |
Right | 1333222 |
Strand | - |
Nucleotide Sequence | GTGAAAAACGTGCGTAAAATTTTCACAGCTATCATTGAATACGATCCTGAAAAAAAGCAATATGTTGGAATGGTTCCAGATGTTCCAGGTGTACATACTGTAGGTAGTTCCTTAGAAGAAGTGAGAAGGAATTTAAAAGAGGTGCTTGAACTCGTATTGGAGGAAGCAGGAGATGAAATAAATCTCCAGGAATTCGTGGCTCTTGAGATGATAGAGGTGGAAACTTGA |
Sequence | MKNVRKIFTAIIEYDPEKKQYVGMVPDVPGVHTVGSSLEEVRRNLKEVLELVLEEAGDEINLQEFVALEMIEVET |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl23837. Profile Description: HicB_like antitoxin of bacterial toxin-antitoxin system. This family consists of several bacterial HicB related proteins. The function of HicB is unknown although it is thought to be involved in pilus formation. It has been speculated that HicB performs a function antagonistic to that of pili and yet is necessary for invasion of certain niches. |
Pubmed ID | 10360571 |
Domain | CDD:420040 |
Functional Category | Others |
Uniprot ID | Q9X139 |
ORF Length (Amino Acid) | 75 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1482030 | 1482257 | + | NC_023151.1 | Thermotoga maritima MSB8 |
2 | 1474382 | 1474609 | + | NC_023151.1 | Thermotoga maritima MSB8 |
3 | 1485138 | 1485365 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
4 | 1477490 | 1477717 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
5 | 1460888 | 1461115 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
6 | 1453240 | 1453467 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
7 | 1224429 | 1224656 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
8 | 1232035 | 1232262 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
9 | 1272809 | 1273036 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
10 | 55987 | 56175 | + | NC_019977.1 | Methanomethylovorans hollandica DSM 15978 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00005.29 | 0.83 | 5 | 2689 | opposite-strand | ABC transporter |
2 | PF00664.25 | 0.83 | 5 | 1977 | opposite-strand | ABC transporter transmembrane region |
3 | PF04055.23 | 0.83 | 5 | 3139.0 | opposite-strand | Radical SAM superfamily |
4 | PF13353.8 | 0.83 | 5 | 2577 | opposite-strand | 4Fe-4S single cluster domain |
5 | PF13186.8 | 0.83 | 5 | 3701 | opposite-strand | Iron-sulfur cluster-binding domain |
6 | PF13424.8 | 0.83 | 5 | 5726 | same-strand | Tetratricopeptide repeat |
7 | PF07927.14 | 0.83 | 5 | -3.0 | same-strand | HicA toxin of bacterial toxin-antitoxin, |