Result : Q9X137

Protein Information

• Protein name: UPF0150 protein TM_1311
• NCBI Accession ID: AE000512.1
• Organism: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
• Left: 1332530
• Right: 1332742
• Strand: -
• Nucleotide Sequence: ATGGAGACGCAAAAGGAGATAGTCTTCATCGCCGTGGAATCGGAGGACGGAGGATACATCGAAAAAACTGAGAGGTATTCGATATTCACGCAGGGAGATACCTGGGAAGAGCTCCTTGAGATGATAAAAGATGCGGTCAAATGCCATTTCGATGAGGGTGCTCCTAAGTACGTACATGCTCGCTTTGTGAAGGATGTGACGATTGCGGTATGA
• Sequence: METQKEIVFIAVESEDGGYIEKTERYSIFTQGDTWEELLEMIKDAVKCHFDEGAPKYVHARFVKDVTIAV
• Source of smORF: Swiss-Prot
• Pubmed ID: 10360571
• Functional Category: Others
• Uniprot ID: Q9X137
• ORF Length (Amino Acid): 70

Conservation Analysis

No. of Species: 8

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1485615	1485827	+	NC_013642.1	Thermotoga naphthophila RKU-10
2	1461365	1461577	+	NC_009486.1	Thermotoga petrophila RKU-1
3	1482510	1482722	+	NC_023151.1	Thermotoga maritima MSB8
4	1232512	1232724	+	NC_011978.1	Thermotoga neapolitana DSM 4359
5	416355	416561	+	NC_009483.1	Geobacter uraniireducens Rf4
6	1767024	1767227	+	NC_013849.1	Ferroglobus placidus DSM 10642
7	1556903	1557085	-	NC_015320.1	Archaeoglobus veneficus SNP6
8	1289896	1290084	-	NC_015707.1	Pseudothermotoga thermarum DSM 5069

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_013642.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF07927.14	1.0	8	10.0	same-strand	HicA toxin of bacterial toxin-antitoxin,