Result : B0B9S0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Trp operon repressor homolog |
| NCBI Accession ID | AM884176.1 |
| Organism | Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) |
| Left | 511407 |
| Right | 511691 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAATCAAGAGGAGTCTGGCTGGCAAGCTTTTCTGACATTATGCTCTAAAATGCAAAAAGAAAAGTTTTTACAAGACCTTTTTTCGCTGTTTTTGTCTTTTGGCGAACGTAAAGATGTCGCTTCTCGCTATCATATCATTCGAGCTCTTTTAGAAGGGGAGCTCACTCAAAGAGAGATAGCAGAGAAATACGGAGTCAGTATCGCACAAATTACCAGAGGATCTAATGCCCTTAAAGGATCAGATCCTCAATTTAAAGAGTTTTTACAAAAAGAGATCTGA |
| Sequence | MKNQEESGWQAFLTLCSKMQKEKFLQDLFSLFLSFGERKDVASRYHIIRALLEGELTQREIAEKYGVSIAQITRGSNALKGSDPQFKEFLQKEI |
| Source of smORF | Swiss-Prot |
| Function | This protein is an aporepressor. When complexed with L-tryptophan it binds the operator region of the trp operon and prevents the initiation of transcription. {ECO:0000255|HAMAP-Rule:MF_00475}. |
| Pubmed ID | 18032721 |
| Domain | CDD:419669 |
| Functional Category | DNA-binding |
| Uniprot ID | B0B9S0 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 192279 | 192563 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
| 2 | 219970 | 220260 | + | NZ_LS398098.1 | Chlamydia suis |
| 3 | 515174 | 515479 | - | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 4 | 771183 | 771416 | - | NC_022439.1 | Chlamydia pecorum PV3056/3 |
| 5 | 647589 | 647894 | + | NC_003361.3 | Chlamydia caviae GPIC |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007899.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12919.9 | 0.8 | 4 | 2358 | same-strand | TcdA/TcdB catalytic glycosyltransferase domain |
| 2 | PF12918.9 | 0.8 | 4 | 2358 | same-strand | TcdB toxin N-terminal helical domain |
| 3 | PF04488.17 | 0.8 | 4 | 2358 | same-strand | Glycosyltransferase sugar-binding region containing DXD motif |
| 4 | PF00291.27 | 1.0 | 5 | 2670.5 | same-strand | Pyridoxal-phosphate dependent enzyme |
| 5 | PF00290.22 | 1.0 | 5 | 3831 | same-strand | Tryptophan synthase alpha chain |
| 6 | PF11996.10 | 0.6 | 3 | 3851.5 | same-strand | Protein of unknown function (DUF3491) |
| 7 | PF00697.24 | 0.6 | 3 | 2064 | same-strand | N-(5'phosphoribosyl)anthranilate (PRA) isomerase |
| 8 | PF00218.23 | 0.6 | 3 | 1253 | same-strand | Indole-3-glycerol phosphate synthase |
| 9 | PF00591.23 | 0.6 | 3 | 231 | same-strand | Glycosyl transferase family, a/b domain |
| 10 | PF02885.19 | 0.6 | 3 | 231 | same-strand | Glycosyl transferase family, helical bundle domain |
++ More..