Protein Information |
Information Type | Description |
---|---|
Protein name | Trp operon repressor homolog |
NCBI Accession ID | AM884176.1 |
Organism | Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) |
Left | 511407 |
Right | 511691 |
Strand | + |
Nucleotide Sequence | ATGAAAAATCAAGAGGAGTCTGGCTGGCAAGCTTTTCTGACATTATGCTCTAAAATGCAAAAAGAAAAGTTTTTACAAGACCTTTTTTCGCTGTTTTTGTCTTTTGGCGAACGTAAAGATGTCGCTTCTCGCTATCATATCATTCGAGCTCTTTTAGAAGGGGAGCTCACTCAAAGAGAGATAGCAGAGAAATACGGAGTCAGTATCGCACAAATTACCAGAGGATCTAATGCCCTTAAAGGATCAGATCCTCAATTTAAAGAGTTTTTACAAAAAGAGATCTGA |
Sequence | MKNQEESGWQAFLTLCSKMQKEKFLQDLFSLFLSFGERKDVASRYHIIRALLEGELTQREIAEKYGVSIAQITRGSNALKGSDPQFKEFLQKEI |
Source of smORF | Swiss-Prot |
Function | This protein is an aporepressor. When complexed with L-tryptophan it binds the operator region of the trp operon and prevents the initiation of transcription. {ECO:0000255|HAMAP-Rule:MF_00475}. |
Pubmed ID | 18032721 |
Domain | CDD:419669 |
Functional Category | DNA-binding |
Uniprot ID | B0B9S0 |
ORF Length (Amino Acid) | 94 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 192279 | 192563 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
2 | 219970 | 220260 | + | NZ_LS398098.1 | Chlamydia suis |
3 | 515174 | 515479 | - | NC_007899.1 | Chlamydia felis Fe/C-56 |
4 | 771183 | 771416 | - | NC_022439.1 | Chlamydia pecorum PV3056/3 |
5 | 647589 | 647894 | + | NC_003361.3 | Chlamydia caviae GPIC |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12919.9 | 0.8 | 4 | 2358 | same-strand | TcdA/TcdB catalytic glycosyltransferase domain |
2 | PF12918.9 | 0.8 | 4 | 2358 | same-strand | TcdB toxin N-terminal helical domain |
3 | PF04488.17 | 0.8 | 4 | 2358 | same-strand | Glycosyltransferase sugar-binding region containing DXD motif |
4 | PF00291.27 | 1.0 | 5 | 2670.5 | same-strand | Pyridoxal-phosphate dependent enzyme |
5 | PF00290.22 | 1.0 | 5 | 3831 | same-strand | Tryptophan synthase alpha chain |
6 | PF11996.10 | 0.6 | 3 | 3851.5 | same-strand | Protein of unknown function (DUF3491) |
7 | PF00697.24 | 0.6 | 3 | 2064 | same-strand | N-(5'phosphoribosyl)anthranilate (PRA) isomerase |
8 | PF00218.23 | 0.6 | 3 | 1253 | same-strand | Indole-3-glycerol phosphate synthase |
9 | PF00591.23 | 0.6 | 3 | 231 | same-strand | Glycosyl transferase family, a/b domain |
10 | PF02885.19 | 0.6 | 3 | 231 | same-strand | Glycosyl transferase family, helical bundle domain |