Result : Q9X0X1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) |
| NCBI Accession ID | AE000512.1 |
| Organism | Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) |
| Left | 1269604 |
| Right | 1269852 |
| Strand | + |
| Nucleotide Sequence | TTGCCGCTCTTTAAATTCGCAATAGACGTTCAGTACAGGAGCAACGTGAGGGATCCGCGCGGAGAAACGATCGAACGTGTTCTGAGGGAAGAAAAAGGTCTTCCCGTGAAAAAGTTGAGACTTGGGAAGTCCATCCACCTCGAAGTAGAAGCAGAAAACAAAGAAAAAGCGTACGAAATCGTAAAGAAAGCCTGCGAAGAACTCCTGGTGAACCCGGTTGTTGAGGAATATGAGGTGAGGGAGCTGTGA |
| Sequence | MPLFKFAIDVQYRSNVRDPRGETIERVLREEKGLPVKKLRLGKSIHLEVEAENKEKAYEIVKKACEELLVNPVVEEYEVREL |
| Source of smORF | Swiss-Prot |
| Function | Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL. {ECO:0000255|HAMAP-Rule:MF_01926, ECO:0000269|Pubmed:18597481}. |
| Pubmed ID | 10360571 23637642 16865708 18597481 |
| Domain | CDD:412569 |
| Functional Category | Others |
| Uniprot ID | Q9X0X1 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1540196 | 1540444 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 2 | 1515988 | 1516236 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 3 | 1545399 | 1545647 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 4 | 1291595 | 1291843 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 5 | 1423126 | 1423374 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 6 | 1194047 | 1194295 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 7 | 1487165 | 1487413 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 8 | 1246221 | 1246469 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 9 | 1465659 | 1465907 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013642.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF16904.7 | 1.0 | 9 | 638 | same-strand | Phosphoribosylformylglycinamidine synthase II C-terminus |
| 2 | PF00586.26 | 1.0 | 9 | 638 | same-strand | AIR synthase related protein, N-terminal domain |
| 3 | PF02769.24 | 1.0 | 9 | 638 | same-strand | AIR synthase related protein, C-terminal domain |
| 4 | PF13507.8 | 0.67 | 6 | -3.0 | same-strand | CobB/CobQ-like glutamine amidotransferase domain |
| 5 | PF01259.20 | 0.89 | 8 | -24.0 | same-strand | SAICAR synthetase |
++ More..