Result : Q9X078
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative sulfur carrier protein TM_0983 |
| NCBI Accession ID | AE000512.1 |
| Organism | Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) |
| Left | 993444 |
| Right | 993683 |
| Strand | - |
| Nucleotide Sequence | ATGGCGAAGTACCAGGTCACCAAGACTTTGGATGTGAGAGGAGAGGTTTGTCCAGTGCCTGATGTTGAAACCAAAAGGGCTCTGCAGAACATGAAGCCAGGAGAAATCCTTGAAGTGTGGATCGACTATCCAATGTCGAAAGAAAGAATCCCGGAAACTGTCAAAAAACTTGGCCACGAAGTCCTGGAAATCGAAGAAGTGGGTCCGAGCGAATGGAAGATCTACATCAAAGTGAAATAA |
| Sequence | MAKYQVTKTLDVRGEVCPVPDVETKRALQNMKPGEILEVWIDYPMSKERIPETVKKLGHEVLEIEEVGPSEWKIYIKVK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00436. Profile Description: N/A. Members of this family of hypothetical bacterial proteins have no known function. |
| Pubmed ID | 10360571 11854485 |
| Domain | CDD:412376 |
| Functional Category | Others |
| Uniprot ID | Q9X078 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1765618 | 1765857 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 2 | 1821568 | 1821807 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 3 | 1569636 | 1569875 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 4 | 1763043 | 1763282 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 5 | 197730 | 197969 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 6 | 921729 | 921968 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 7 | 878675 | 878917 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 8 | 859510 | 859749 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 9 | 1371433 | 1371672 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 10 | 1392922 | 1393161 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 11 | 888246 | 888488 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 12 | 885862 | 886086 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 13 | 1514227 | 1514466 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 14 | 1511592 | 1511792 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 15 | 2796375 | 2796614 | + | NZ_LS974202.1 | Mesotoga infera |
| 16 | 2799067 | 2799273 | + | NZ_LS974202.1 | Mesotoga infera |
| 17 | 14315 | 14554 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 18 | 18682 | 18888 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 19 | 653640 | 653879 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 20 | 656349 | 656543 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 21 | 1736546 | 1736785 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 22 | 846026 | 846268 | - | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 23 | 516668 | 516874 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 24 | 380251 | 380445 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 25 | 1318129 | 1318368 | - | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 26 | 391277 | 391516 | - | NC_017096.1 | Caldisericum exile AZM16c01 |
| 27 | 104311 | 104505 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 28 | 89935 | 90129 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 29 | 941779 | 942021 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 30 | 90140 | 90382 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 31 | 1377421 | 1377642 | + | NZ_CP058215.1 | Methanolobus zinderi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_023151.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02635.17 | 1.0 | 26 | 1070.5 | same-strand | DsrE/DsrF-like family |
| 2 | PF04077.14 | 0.92 | 24 | 1767 | same-strand | DsrH like protein |
| 3 | PF04143.16 | 0.92 | 24 | 21.0 | same-strand | Sulphur transport |
| 4 | PF01206.19 | 0.62 | 16 | 2098.5 | same-strand | Sulfurtransferase TusA |
++ More..