Result : Q9WY93
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | AE000512.1 |
| Organism | Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) |
| Left | 263980 |
| Right | 264231 |
| Strand | + |
| Nucleotide Sequence | GTGCTGGTTCTCACTAGAAGAGTAGGGGAAAAGATCGTGATTGGTGAAGACATAGTGATTACTGTCCTGAAGATAGAGGGGAATTCTGTTAAAATTGGTATAGAGGCACCCAAACATGTGAAGATTCTTCGTGAGGAACTCTACGAAGAACTCAAGAGTGAGAACATAAAAGCTTCTGAAGTTTCAAAAGATGACCTGAAGGGGGTTTTAAGGAATGATAAAGGTTACAAAGGACCTAGTGCTTCATCTTGA |
| Sequence | MLVLTRRVGEKIVIGEDIVITVLKIEGNSVKIGIEAPKHVKILREELYEELKSENIKASEVSKDDLKGVLRNDKGYKGPSASS |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 10360571 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | Q9WY93 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 39
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 681387 | 681638 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 2 | 915274 | 915525 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 3 | 679295 | 679546 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 4 | 431457 | 431708 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 5 | 786433 | 786684 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 6 | 877595 | 877846 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 7 | 1758552 | 1758794 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 8 | 1159960 | 1160202 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 9 | 2872651 | 2872902 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 10 | 138158 | 138406 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 11 | 476799 | 477020 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 12 | 1051528 | 1051752 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 13 | 3154882 | 3155130 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 14 | 281384 | 281605 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 15 | 249184 | 249411 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 16 | 3006553 | 3006771 | - | NZ_CP030775.1 | Clostridium butyricum |
| 17 | 601505 | 601720 | - | NZ_CP023671.1 | Clostridium septicum |
| 18 | 1575912 | 1576139 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 19 | 2835938 | 2836156 | - | NZ_CP028842.1 | Clostridium botulinum |
| 20 | 614490 | 614729 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 21 | 1418612 | 1418827 | + | NZ_CP040924.1 | Clostridium thermarum |
| 22 | 4988197 | 4988415 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 23 | 2184910 | 2185131 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 24 | 3067851 | 3068069 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 25 | 404339 | 404572 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 26 | 901641 | 901856 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 27 | 2636505 | 2636720 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 28 | 2724268 | 2724495 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 29 | 1134230 | 1134457 | + | NZ_LR590481.1 | Hathewaya histolytica |
| 30 | 1460861 | 1461091 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 31 | 2612721 | 2612945 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 32 | 1638988 | 1639239 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 33 | 1017009 | 1017251 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 34 | 2766956 | 2767159 | - | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 35 | 476614 | 476841 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 36 | 509414 | 509641 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 37 | 777447 | 777674 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 38 | 949564 | 949791 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 39 | 1755702 | 1755938 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP059066.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05130.14 | 0.64 | 25 | 3647 | same-strand | FlgN protein |
| 2 | PF00669.22 | 0.77 | 30 | 529 | same-strand | Bacterial flagellin N-terminal helical region |
| 3 | PF00700.23 | 0.72 | 28 | 536 | same-strand | Bacterial flagellin C-terminal helical region |
| 4 | PF02623.17 | 0.85 | 33 | 5 | same-strand | FliW protein |
| 5 | PF00460.22 | 0.62 | 24 | 1988.0 | same-strand | Flagella basal body rod protein |
++ More..