Result : Q9WXD8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein PufQ |
| NCBI Accession ID | AB020784.1 |
| Organism | Rhodovulum sulfidophilum (Rhodobacter sulfidophilus) |
| Left | 1146 |
| Right | 1367 |
| Strand | + |
| Nucleotide Sequence | ATGACTGACCAGACTTCCGACGTTCACATGGTACGTGGCCACCGCCCGCCGAAGGCGGAGTTCATGGTCTATTTCACGATCATCTTCATTGCGGCGCTGCCGCTGGCCTTCATCGCCTCCTTCCTGGCGATGGTCCGGCAGGGCGACCTGAAGACCAAGGGGCCGATTGCCCGCGCCTGGAGTCAGGCGCGGATCATCACGCCCATGATTTTCTCTGCCTGA |
| Sequence | MTDQTSDVHMVRGHRPPKAEFMVYFTIIFIAALPLAFIASFLAMVRQGDLKTKGPIARAWSQARIITPMIFSA |
| Source of smORF | Swiss-Prot |
| Function | Required for bacteriochlorophyll biosynthesis. Directly involved in the assembly of both the B875 and B800-850 pigment-protein complexes. |
| Pubmed ID | 10196154 |
| Domain | CDD:310184 |
| Functional Category | Others |
| Uniprot ID | Q9WXD8 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 860316 | 860537 | + | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 2 | 3701062 | 3701286 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 3 | 2549957 | 2550175 | - | NZ_CP061498.1 | Roseicitreum antarcticum |
| 4 | 1071662 | 1071880 | + | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009952.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00142.20 | 1.0 | 4 | 3134.5 | same-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
| 2 | PF01656.25 | 1.0 | 4 | 3134.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 3 | PF00148.21 | 1.0 | 4 | 746.5 | same-strand | Nitrogenase component 1 type Oxidoreductase |
| 4 | PF08369.12 | 1.0 | 4 | -3.0 | same-strand | Proto-chlorophyllide reductase 57 kD subunit |
| 5 | PF00556.22 | 1.0 | 4 | 251.0 | same-strand | Antenna complex alpha/beta subunit |
| 6 | PF00124.21 | 1.0 | 4 | 1070.0 | same-strand | Photosynthetic reaction centre protein |
| 7 | PF02276.20 | 1.0 | 4 | 2467.5 | same-strand | Photosynthetic reaction centre cytochrome C subunit |
| 8 | PF00891.20 | 0.75 | 3 | 5149 | same-strand | O-methyltransferase domain |
| 9 | PF13489.8 | 0.75 | 3 | 5149 | same-strand | Methyltransferase domain |
++ More..